Home 

Gene Symbol:  
HMPREF0514_11733
Organism:  
Lactobacillus gasseri JV-V03
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
16452..17237 [1], 786 bp
Product Function:  
hypothetical protein
Product Locus:  
 ZP_07058976.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:786 bp
>HMPREF0514_11733|ThioFinder954 Lactobacillus gasseri JV-V03
ATGAAAGTATATAAAATAATAAATGGTACTAATGCAAAAAGAAATAAATTTAATAGTGTCTCCTTTTATA
CTTATAGTAGAGAAAGTAATAACTTGTGGTGCTATGTTAAAAGTAAGCAGGGAACAGAAATAAAATTAAT
AGATAAAAAGATGGGAAACGTTGCTGAAGAGATTATTGAACAATTCTTTATATCTATGGGTAAACAGACT
ATAAAGATATCTGAGTGCTCCAACTTTTATAATCAGATTATTTTATTGATGATAAGCTTTCTAGACATAA
ATTATAACGGAGAAATTTTTAGAGGTGGTCAGTCTTTTTGCTCACATGCTAACGGCTTTATTACATTTTC
ATCAGATCCCAAAATGGCCAAGCAAAGGTTAGAGCAATATTATTTAAAAAATAAGGATATTCTAATTAAT
ATTGTAAATTTATATTGTAAAGGAAAAATTGGTAAATTTGAGAAAAATAATATGAAAAATATTTTTGTCA
GTTTAGATGAGGAAGTTAAGTCTTCTATAAGAGATAATAAAATCTATTTCATTAATTATTCCCAAAATAA
TTTATTAAAAAAAAGTAATTTTCATGTTCGTTTTTACGAAAAGCATAAGTCTTTATTTAGTAATGAACAA
TTTAAAAAAGAAAGATTCATGACCATTTGTTTTTATCAATATCTTTATTTTTGCTTAAAAATAAATTATA
AAACTAGGAGTGAGTTGGATTACTTAATATATAGAGCACTAGAAGATTTTTATAACAAAAAATATTTGAA
TATAGTGAACAGGTAG
 Primer design

Protein Sequence:261 a.a.
>HMPREF0514_11733|ThioFinder954 Lactobacillus gasseri JV-V03
MKVYKIINGTNAKRNKFNSVSFYTYSRESNNLWCYVKSKQGTEIKLIDKKMGNVAEEIIEQFFISMGKQT
IKISECSNFYNQIILLMISFLDINYNGEIFRGGQSFCSHANGFITFSSDPKMAKQRLEQYYLKNKDILIN
IVNLYCKGKIGKFEKNNMKNIFVSLDEEVKSSIRDNKIYFINYSQNNLLKKSNFHVRFYEKHKSLFSNEQ
FKKERFMTICFYQYLYFCLKINYKTRSELDYLIYRALEDFYNKKYLNIVNR