Home 

Gene Symbol:  
SSDG_06096
Organism:  
Streptomyces pristinaespiralis ATCC 25486
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1827227..1828235 [-1], 1009 bp
Product Function:  
predicted protein
Product Locus:  
 ZP_06908857.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1009 bp
>SSDG_06096|ThioFinder859 Streptomyces pristinaespiralis ATCC 25486
GTGTCTGTCCGCCGCGGCGTCCGGCCTGTTCGCGCGCCCCGTCAGGGCGTTCAAGGAGATACCCGTACAG
CGCGTCCTCGGCCTGGAGGAGGACGAGACGATCGTCCTGTCCGCGGTGGTGGGAGTCCCGCAGGACACCG
GCGGCGCGCTGCTCGACCTGAGACTGTGAAGGAGCGCTCCATGACATGGAATTCGTGGCACCTGCACCTC
GCCACCACCGCCAGGTCCGCCCACGACCGGGTGCTGACCCGGGTCGTCGGACCGACCGTGCGGGAACTGG
CGGCGGACCGGCCGTGGTTCTTCATCCGCTACTGGCAGGCCGGCCCCCATCTGCGGCTGCGCATCGCCGA
CCTCGACCCGACGACGTACGGACGGGTCGAGGCCGCCCTGCGGGAGCGGCTGGCCGACGCCGGCCGGCTC
ACCGCCGGTGAGGAACCCCTGGCGGCCGAGGACTACCGGCGGAGCGCCGGACAGCTGGCGTCCGCGGGGG
AGCAGGGGGAGGACCGGAACGTCCGCGAACTGCTCGCCCCCGGCGTCCACCGCGCCATCTACGAGCCCGA
GTTCGACCGCTACGGCGGCCCCGCGCTGATGCCCGCCACCGAGGCCCTCTTCCGCCTCTCCAGCGAACTG
GTCCTCGGCCTGGTCCCCAAGGCCGTGACCGAGCGGCACCGCGCCCTGCTCGCCCTGCGCGGCACCATGG
CCGCCGCGGCGGCCCTCGGTGACGCGACGGAACGCACGTACTTCTACGCCCACGGTCTCGGCGCCTGGCG
CGCCTGGGCCGGCGACGCGGGATACCCGGGCGACCTGCTCGACTCCGTCACCACCATCACCCGGGCCGCC
GGGGCCGCACCCGTCGACCCGCTGGACCACGGGGTGTTCGCCCGCTGGCACGACGGGCTCGCGGCGCTGA
CCGGCGACCTCCGCGAGAAGTCGGACACGCACCCCGGCATGGTCCTGTTCTCGCACGCGCACATGCTCCA
CAACCGCCTCGGGCTGAGCCTGCTCGAGG
 Primer design

Protein Sequence:335.33333333333 a.a.
>SSDG_06096|ThioFinder859 Streptomyces pristinaespiralis ATCC 25486
MSVRRGVRPVRAPRQGVQGDTRTARPRPGGGRDDRPVRGGGSPAGHRRRAARPETVKERSMTWNSWHLHL
ATTARSAHDRVLTRVVGPTVRELAADRPWFFIRYWQAGPHLRLRIADLDPTTYGRVEAALRERLADAGRL
TAGEEPLAAEDYRRSAGQLASAGEQGEDRNVRELLAPGVHRAIYEPEFDRYGGPALMPATEALFRLSSEL
VLGLVPKAVTERHRALLALRGTMAAAAALGDATERTYFYAHGLGAWRAWAGDAGYPGDLLDSVTTITRAA
GAAPVDPLDHGVFARWHDGLAALTGDLREKSDTHPGMVLFSHAHMLHNRLGLSLLE