Home 

Gene Symbol:  
SSDG_06099
Organism:  
Streptomyces pristinaespiralis ATCC 25486
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1833844..1836123 [-1], 2280 bp
Product Function:  
predicted protein
Product Locus:  
 ZP_06908860.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2280 bp
>SSDG_06099|ThioFinder862 Streptomyces pristinaespiralis ATCC 25486
GCCGCCGTACCAGCGCCGCCGGCCGATCAGCACGTCGCCGACGGCCATGCGGGGCGCGGTCCTTGTGGTG
CGCCCGTCCCACGGGGTGGCGGCGTGCCAGCTGTTCGGCAGGCTGTTGAAGAGCCGGCCGCTGATGACGA
GACCGGAGGCCACCGACAGCGGCGGCGGGAACAGTCCGGGGTGGCCGGTGCCGAGCGGCAGCACCCGCAG
CGGGGCGCCGTCGGCGTCCTCGACGTGCAGCGTGTCGGTCGCTCTGTCGTGCACCAGACGCAGGGTGAAC
CAGTCCTCCGGCGTGAGGCCGCCGGGCAGGATCGGCGTGTGGGCGTTGACGTTCAGCCGGTGCAGGCCGA
GGTCCTCCGTGACGCGGGCGCCGTCGAATCCGTAGGCGCGCCGCAGGTGTTCCTCGAGGAGCGGCAGCGC
CCTGCCGCCCTGGCGGCGGTCGGCCTCCAGGAAGCGGGCGTAGAGCATCCCGTGCCCGGGCAGCCCGTCG
TTGAGGATCAGCTGCTGCCCGGCCTGCTGGAGGAGCACGCCGTAGATCAGCGGGTCCTGGCGGAAGCGGT
CGGGCAGCGCGTCGGTGAGTCCGGCGACGTCTCCGGGCGTCAGGACGAGGGTGTCCTCTCCCGCCTCCGC
GACCTTGGTCAGGCGGGTGTGGACGGCCTCCGTCAACTCGCGGCGCAGCAGGTACATCCGCTCCAGCGAG
CCGTCGGCGGGGCCGATGCCGGCGAGCGCGGACGGGTCGCCGGTGCCCTTCGGCCCGTACACGGCGTCCA
TGGCGGCGGCCCGGCGCGAGACCTCGCCGACCACGAAGGCGGCGTTGGCGGCGAGGGGCACGTCGGCCCC
GGCGCCGAACCGTTCGACGAACGCGGCGGTCATCAGGACCCGTACGTCGTGCAGCCAGTCGAAGACGGTG
AGGAGTTCGACGGCGGGCCCGAGGTCGGCGAGGGGCTGCCGCCATTTGTCGGTGGCCACCTTGAGCGGTG
GCATGACGTAGTCCTCCTCGACCGTGATCCGGGCGGGCCGCCGGGCGAGGTGGCTGAGCCTGCCGAGGTC
GTCGCGCAGGGAGGCGAGGACGGCGCCGCGGCCGGCGGCGGGCGCGGCCGCCAGCTCCGGCAGGCCGGCC
TTGATGCTGTCGGTGAGCCCGGCGGCGCGGGGGTCGCCGGGGCTGAGCAGGTCGTCGTAATCGGCGGCCC
CGTCCTCCGCCTCGTGGAACGAGCACAGCAGGCCCTGGCCGAGGGCGTGCCGCACCCGGCGCTCCGCGTC
CTGCTCCGCGCAGCCGGCGCGTTCGGCGACGTGCCTGACCACGGAGGGGTACGGGCGGGGTCCCATGGAG
ACCGCGTCGAGCAGGTCACCGGCGGGGCCGTCGAGGGGCACGGCGAGCCGGCGCATGCCGGCGTCGGTGA
GCTTCAGGAAGAACAGCTTGCCGGCCTCCGGGTCGGGCGCGGAGGTGGGCGGCAGTCCTACCCACAGGTC
CGCGAGCGCCGCGTCGTCGGGGGCGGGCAGGCCGCCGAGCACATAGCCGAGCATGACCCGGTCGAGGCCC
GGGAACGCGGTCGCGCCGGTGAACGGCACATCGTCCGGGTCCACCCCCTCCGGGTCGGGCTCCGCGATGC
CGACGGCGGTGAACCGGGACAGCGGGCTGGTGCGGACCATGGCCCGGGTGACGTACTGGATCAGTCCGCG
CTCCGACTTGCGGGTACGGGCGGAGACGTTGCCGGGGCCGAGGACGGCGGCGCGGTAGCGCTCCGCCTCC
TGGTGCACCTCGGGCGCGACGAGCGCCAGCGAGCGCAGCAGGTCGTCGTCGCCCAACAGGGCGGCGAGGC
GCTCGCGTTCACGGTCGGCCGCCGCCGCGTAGCCGCTCGTGATCTCGTCGCGCAGCCGCTCCCTGCGCTC
GCGCGCCGCGAGCCACCGGTCGACGGCGGGGGTGGGGACGGGCGGCTTCTTGGGGGCGCGGTCGTTGTGG
ACGGTGCGCCGCAGGGCGATGAGTTCGCGGCGCTCGGCGTCGTCGGCCGCGTCACCGATGCGGTGGTAGA
GCTCGTCGGAGCACGCGTCGGCGGCCGTGCGCAACGCGTTCTCGGCGTCGGCGAGTTCGGCGAGCAGTCC
GCGCTGCCCGGGGTCGGCGAGCCGGGTCCGGCGCAGCGGATTGACCCGCAGGAACCAGAGCGGTTCGGGT
TCGGGCGCCGTGGACACGGACGCCGGGGCCGGGTCGGGTGCGGGCGCGGCCGGGGGGCCGGCGGTGGCCC
ATGTGGTGTGGGTGGCTGATTCGGTCGTGGGCGCGGTCAT
 Primer design

Protein Sequence:759 a.a.
>SSDG_06099|ThioFinder862 Streptomyces pristinaespiralis ATCC 25486
MTAPTTESATHTTWATAGPPAAPAPDPAPASVSTAPEPEPLWFLRVNPLRRTRLADPGQRGLLAELADAE
NALRTAADACSDELYHRIGDAADDAERRELIALRRTVHNDRAPKKPPVPTPAVDRWLAARERRERLRDEI
TSGYAAAADRERERLAALLGDDDLLRSLALVAPEVHQEAERYRAAVLGPGNVSARTRKSERGLIQYVTRA
MVRTSPLSRFTAVGIAEPDPEGVDPDDVPFTGATAFPGLDRVMLGYVLGGLPAPDDAALADLWVGLPPTS
APDPEAGKLFFLKLTDAGMRRLAVPLDGPAGDLLDAVSMGPRPYPSVVRHVAERAGCAEQDAERRVRHAL
GQGLLCSFHEAEDGAADYDDLLSPGDPRAAGLTDSIKAGLPELAAAPAAGRGAVLASLRDDLGRLSHLAR
RPARITVEEDYVMPPLKVATDKWRQPLADLGPAVELLTVFDWLHDVRVLMTAAFVERFGAGADVPLAANA
AFVVGEVSRRAAAMDAVYGPKGTGDPSALAGIGPADGSLERMYLLRRELTEAVHTRLTKVAEAGEDTLVL
TPGDVAGLTDALPDRFRQDPLIYGVLLQQAGQQLILNDGLPGHGMLYARFLEADRRQGGRALPLLEEHLR
RAYGFDGARVTEDLGLHRLNVNAHTPILPGGLTPEDWFTLRLVHDRATDTLHVEDADGAPLRVLPLGTGH
PGLFPPPLSVASGLVISGRLFNSLPNSWHAATPWDGRTTRTAPRMAVGDVLIGRRRWYGG