Home 

Gene Symbol:  
SSDG_06098
Organism:  
Streptomyces pristinaespiralis ATCC 25486
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1829250..1830831 [-1], 1582 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_06908859.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1582 bp
>SSDG_06098|ThioFinder861 Streptomyces pristinaespiralis ATCC 25486
GACCGAGCCGGTCGCCGTGCTGGAGGCGTACGAGCGCCTCGGTGGTTTCCCGTACGACATCCCGGTCCTC
ACGGGCCGTGCGTACAAGGACGTCGCCGAGTACGCCGTGGACCCCGGCACGCTCGGCAGGTACACGCAGG
AGCAGCTCGACCACCCCACCTCACGGGTGACGCCCTCGGACGAGCACACCGAAATGGACTGGGTGTGGGG
CCACGACCTCACCGACGGCCGGGCCCTGCTCGTCCCCGCCGACCACGCCTTCTACCAGTACGAGTACGCC
TTCCGCAGGGACCGCCGCGCGGCCCGCGCGGTCGGCCCGCACGAGCGCAAGCACTACTTCTACGAGTCCT
CCAGCGGCTGCGCCGTGGGCGCCAACCTCGAGGAGGCCGCGCTCCACTCGCTGTTCGAGCTGGCCGAGCG
CGACGCCTTCCTCACCTGCTGGTACCGGGCGAGGCCGCTGCCGTACATCCCCGAATCGTCGATCACCGAC
CCGACGAGCCGGGCCATGATCGAGCTGGTCCGGGCCAGGGGCTTCGACGTGCACCTCCTGGTCGCGACCC
GGGACATCGCCCTGCCGGTGGTGTGGGTCCTCGCGGTGAACCGCAGGAACCCGTTCCCGGCGACCTTCTC
CTCCGCCGGCTCCGGCGCCGACCCTCGGTCCGCGATCCGCGGCGCCCTGCGGGAGGTCGCCCAGCTCGTC
ACCAACCCCGTCGACTGGACGCGCGAACAGGTGGAGCCGATGGTCGAGGACCCCTGGCTGGTGCAGGAGC
TGGAGGACCATGTGCGCTTCTCCTCGCTGCCGGAGACCCGCGAGCGGGCCACCGTCACCCTCGGCGGCCC
CGCGGTCGCACTGGAAGAGGCGTTCCCCGGCTGGCCGCAGCGCCTGGCACGGGAGTCCGGCGGCGACGTC
CGCGGCGCGCTCGACTTCGTACGGAGCCTGTTCGCCGACGCCGGCCTCGACCAGGTCGTGCTCGTCGACC
AGACCAGCCGCGAGCACGCCGACGCCGGCATCTCGGTCGCCCGCGCGGTCGTGCCGGGCATCGTGCCCAT
GTGCTTCGGGCACGCCCAGCAGCGCCTCGCCGGGCTGCCGAGGCTGGAGGCCGCCCTGCGCGGCACCGGC
AGGAGCAACGGGCCGTCCCCTACGACCCGCACCCCCACCCGTGACGGCGCCCACCGCACCCCGCGGCGGG
TCCGCGACCGGCCGCGGCTGCCCGGTCGACCTGCCGGGGCCCGAGGGCGACAACAGCATCGCCCGCGAAC
CGCTCTGGTACGCGTACGGCGCCGGCGACGACGAACCGGCCGCGCCGGAGTGGACGTGGACGCCCGAGCC
GCCGCCGGACGATCACGTCCCGCCCCCGCCGCCGCGCGGCCGGGGCGCCCGCACGACCCTGCCGCTGGGC
ACGGTGGACCTCCTGGAACGCATGCCGTTCCCACGGGTCCCCGGCGGCCCGGGGCGGACGGGTGGCGCTG
CGGTCTCCGGCGGCCCCGGGCCGGCGGGCGGCACTCCCGTCCCCGGCGGCTCCCGAGTGACCGACCCGCT
CGGCCGGGCGCTCGTCACCGCGTTCGGGCCGCAGCGGCGTGA
 Primer design

Protein Sequence:526.33333333333 a.a.
>SSDG_06098|ThioFinder861 Streptomyces pristinaespiralis ATCC 25486
TEPVAVLEAYERLGGFPYDIPVLTGRAYKDVAEYAVDPGTLGRYTQEQLDHPTSRVTPSDEHTEMDWVWG
HDLTDGRALLVPADHAFYQYEYAFRRDRRAARAVGPHERKHYFYESSSGCAVGANLEEAALHSLFELAER
DAFLTCWYRARPLPYIPESSITDPTSRAMIELVRARGFDVHLLVATRDIALPVVWVLAVNRRNPFPATFS
SAGSGADPRSAIRGALREVAQLVTNPVDWTREQVEPMVEDPWLVQELEDHVRFSSLPETRERATVTLGGP
AVALEEAFPGWPQRLARESGGDVRGALDFVRSLFADAGLDQVVLVDQTSREHADAGISVARAVVPGIVPM
CFGHAQQRLAGLPRLEAALRGTGRSNGPSPTTRTPTRDGAHRTPRRVRDRPRLPGRPAGARGRQQHRPRT
ALVRVRRRRRRTGRAGVDVDARAAAGRSRPAPAAARPGRPHDPAAGHGGPPGTHAVPTGPRRPGADGWRC
GLRRPRAGGRHSRPRRLPSDRPARPGARHRVRAAAA