Home 

Gene Symbol:  
SSDG_06100
Organism:  
Streptomyces pristinaespiralis ATCC 25486
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1836121..1837299 [-1], 1179 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 ZP_06908861.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1179 bp
>SSDG_06100|ThioFinder863 Streptomyces pristinaespiralis ATCC 25486
CATCGTGGGGCTCCCGTGGGGTCGGCTGTGGTGGCGGCGCCCGCACCGGGCCGCCGGGCGTCCAGTCGCT
CCTGCCAGGACGTGCCGAGGACGTCGTCCACCGTCTCGGCGACGGCGAAGCACATGTAGTAGCGCTGCAT
CGGCGAGACGGTCAGCAACGGCAGCTGCTCGTAGAAGAGGTTGGTCAGCAGCCGGAACGCGGCGAACCAC
GGCGAGGGGTCGGCGACCGCTCCCGACGCGTCGACGGCCCGGTGGAAGTCGCTGTCCGGCTGCTCGCCCC
GCGGGACGACGCGGGTCGCTCCGGGCGGGCCCATCTCCGTGCGGTCGACCCCCTCGGTGACGCCGTCGAG
CAGTCCGAGCGTGAGGGTGCCCGCGGCCACGGCGCTCTCCAGCGCGCCGGAGCTGTACGCGAACGCGGTG
CGCCACTCCGCCGCGGCGGGCGATACCTCGCCGCTCAGGCGCTGTTCCACGACGGCCCTCAGCCGCGGCG
CGTCCTCGGCGAGGCGCTGGACGAACAGGGGCCTGACGTCCTTGGTCGGCGCGGCCCAGGCGAGGAACGC
CTCGACGTGGGGAGCGCGGTGAGAACACCCCGTACGCGGGGCCGAGATAGTGGGTGTCGGCCAGCGCGGC
GAACGCCTCGGCGAGGCGGACGGTGGCGGTGCCGGGGTCGTGGGCGATGCCGTCGATCGTCCGCAGCAGC
GGCTTGTTCAGCGCGCCGAGGACGACGGTACGGAAACGGTCGAGCCTTGGTTCGCGGGAGCGGGTGTCGC
CCGGGGCGACGGCCTCGACGGCGCCGTGCTCGCGCAGCGGAAGGTACGGCGGCTGCACCGCCTCGAGCCG
GCCGAACTCACGTGCCTGCTCGAGGTAGGCCTCCTCGGTCAGTGCCCGCGGCGGGTCCAGCGGCCCGGCG
TCCAGCCGGCGCGCGACGTCCGCCCAGTCGGGGCCGCCGCCCGGCAGGCCCGGCGCCGACAGCGCGAGGA
TGTCGACGTGGGGTCCGTGCAGCCAGCCGCGCCGCAGCTGGACACCGGCCGCTCCCTGCTCGCCCAGTGC
CCGGGCGACCGGCACGACGTGCCGGGCCAGCCATGCCGGTGTGACCGGCATCCGTGTGTGGAGCCGCACC
CCCGTCAGGCCGGCGGAATCCGGCCTCACGGCAATGCGCTCCGGCGCATCTACCCCCAT
 Primer design

Protein Sequence:392 a.a.
>SSDG_06100|ThioFinder863 Streptomyces pristinaespiralis ATCC 25486
MGVDAPERIAVRPDSAGLTGVRLHTRMPVTPAWLARHVVPVARALGEQGAAGVQLRRGWLHGPHVDILAL
SAPGLPGGGPDWADVARRLDAGPLDPPRALTEEAYLEQAREFGRLEAVQPPYLPLREHGAVEAVAPGDTR
SREPRLDRFRTVVLGALNKPLLRTIDGIAHDPGTATVRLAEAFAALADTHYLGPAYGVFSPRSPRRGVPR
LGRADQGRQAPVRPAPRRGRAAAEGRRGTAPERRGIARRGGVAHRVRVQLRRAGERRGRGHPHARTARRR
HRGGRPHGDGPARSDPRRPAGRAAGQRLPPGRRRVGSGRRPLAVVRRVPAADQPLLRAAAVADRLADAAL
LHVLRRRRDGGRRPRHVLAGATGRPAARCGRRHHSRPHGSPTM