Home 

Gene Symbol:  
ORF3
Organism:  
Actinomadura melliaura SCC 1655
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2862..3689 [-1], 828 bp
Product Function:  
unknown
Product Locus:  
 ABC02781.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:828 bp
>ORF3|ThioFinder1117 Actinomadura melliaura SCC 1655
GTGTCGTGGCTGAGCGCGCACCTGTTCGACCCGGGCGACCTGGACGATCTGCTGCTGAAGACGGTGCGCC
CGCTGATCACCGAGCTGACCGCCGACGGCCTGTGCGAGTCGGCGTTCTTCCTGCGTCACGCCGACGGCGG
GCCGCACATCAGGATGCGCGTGCTCACCGGCGATCCCGGCGCCGCGTGGGAACGGATCCGTGCCCGCGCG
CACACCCTGCGGACGAGGCCCGTGCTGGTGCCGTACGAGCCCGAAAACGACAAGTACGGCACCGGGGCGG
CGCTCGAGGCGGCCGAGCGGCACTTCGCCGAGTCGAGCGCGCTCGCCGGCCGGGTCCTGGCCCAGCGGCC
CAGCCCGGCCCAGCGAGTGGCGCTGACCCTGTCGTGCGTCCTGCTCACCCAGCTCACCGGCGAGTCCGGT
CCGCGCGCGGCCGCCGTCCGCCTGGCTGAGGGCCTGCGCTGGTGGAAACCGTACGAACCAGGCCCGGTGG
AAGAGCCGCCCGAGCAGGTGGTACGGCATGCCGAGCTGATGTGGCGCGCGGCCCGCGGCGAGTACGAATG
GTCCCCCGCCGCGCCGGAATCGGCCTGGCAGGCGACGATCCGCACCCTGCACGACACCTGGGTCGCGCTG
GACGACGCCGGACGCTTCAACGCGCGGCGGCCGCTGTGGGCCGACCAGGCCGGCACCGGCCGCCACCCCG
CCGTGCGCGTGGCGCTTGACCACTGCGCGCACCTGTTCGCCAACCGGCTGGGCGTGCCGATGGACACCGA
GGCCGCCCTGCGCCGGATCGCCGCCGCCGCGACCACCCGTCTGGGAAGGACCGCCTAG
 Primer design

Protein Sequence:275 a.a.
>ORF3|ThioFinder1117 Actinomadura melliaura SCC 1655
MSWLSAHLFDPGDLDDLLLKTVRPLITELTADGLCESAFFLRHADGGPHIRMRVLTGDPGAAWERIRARA
HTLRTRPVLVPYEPENDKYGTGAALEAAERHFAESSALAGRVLAQRPSPAQRVALTLSCVLLTQLTGESG
PRAAAVRLAEGLRWWKPYEPGPVEEPPEQVVRHAELMWRAARGEYEWSPAAPESAWQATIRTLHDTWVAL
DDAGRFNARRPLWADQAGTGRHPAVRVALDHCAHLFANRLGVPMDTEAALRRIAAAATTRLGRTA