Home 

Gene Symbol:  
ORF4
Organism:  
Actinomadura melliaura SCC 1655
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3692..6331 [-1], 2640 bp
Product Function:  
unknown
Product Locus:  
 ABC02782.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2640 bp
>ORF4|ThioFinder1118 Actinomadura melliaura SCC 1655
TCATGAGACCTCCACAAGGAATTCGGTCACCCGGCCCGCCGGGATCGGCAACGCCTCGGTGAACAGCAGG
GCCTTCTCCTCGGGGCGTTCGCGGATGTCGCGGTCGAGCGCCAGGAGGAGGAACCAGTTCGCCGGGTCGA
AGTACAGGGGTTTGCGGGACTTGGCGAACAGGCCGGTGCCCGCTCGCAGCGACGGGACGTCGAGGATGCG
GACGAAGCAGGGTGCCGGAATGCCCGCCTCGCGTCGCCACCGCTCCATGCGCAGCAGGAAGCGGGCGTCT
TCCTCGCCGGAGGCGCGCCGGGGCACCTCGGCGGCGCTGATCGCCCAGGTGCGCCGCAGGAGGGTCACCC
GGCCGAGGTCGACCCTGGGTGTGTGCACCACCGTCCGGGGAGGCTCGGCGCGGCCCACGTCGTGCAGCCA
GTTCTGATTGGGGAAGAGCACGGTGGGGGTGGGGGCGAAGATCTCGGCCAGGAACCTGGCCGGCGGGGGC
AGGAAGATCTCGGACATGACGCCGGTGTGGGGTGGCACGACCTGCCGGCGCAGCCGCGGCCAGCGAAGCA
CGGGCAGGCCGGTGATCGGGTCGAGCGAGACGGTCAGCTCGCCCAGCGGCGCCACGAGTCCGGGACGGCG
GGTGCTGGACAGGGACGGGTAGCCGATCGAGTGGGTGGCGGCGGGGCTGCGGGCGTTCAGGGTGAAGTCG
AAGAGGTTCTCCAGCTCGGCGACGAGGGGACCGTCCTCGGACAGCTCGGCGATGAGGGGCTCGTCATCGG
GCGGCTGGGCGACGAGGGGGTCGTTGTCGGGTGGCTCGTCGCGGGTGCGGTGCCGTCCGGCGAGCTGTTC
GACCCTGGTGCGCCCGCGCCCGCCCGCGCCGGCCACCGAGTTCAGCACCAGGCGCAGGCCGTCCTCGCCC
GTGCAGGGCTGCACGTAGTAGGCGTGGGCGCCGGGCGGTCCGGTCAGGTGCGCGGCGGTGGCGCCGAGCT
TGATCGCCAGCTCCGGCGGGATCCGCACCACGCCGTCGGCGCCGGGCCGTAGGGCGCGGAGGGTTTCCAG
GGCGCCGGCCCGCAGCCGCGCGACCTCCCTGACCCGCGGGGAGACGCTGGCGGTCAGTCGCGCGAGGGGG
ACGACGCCGCCCTCGGTGGGATCCATGGTCCGCAGGAGCCTCAGGCCGGCGGCGACCGGGTCCTCGGTGT
CCCCGCTGATCGCCTCGTAGAACAGGACGAAGGGGATCTCCGCCGTGCGGCCGAACCGCCGGGTGAAGTA
GTGGGCCGCGCAGTGGCGCACCGGGAGGTTGCGGTCCAGCAGGGCGACGAGCGCGCCGAAGGCGGACAGG
TCCGCGAGCGCCTGCCGCCAGGAGTCGTCCAGCGTGATCGCAGGGGGTGTGTCGAGGATGGCGTGCTCGT
CGAAGGCAGCCGGGTGACGGCCGGCCCGGCGGCCGGGGGAGAGCCCGGCCAGCTTCATGGCCTCCTCCAG
GTGTCCGGTCGAGGAGGCGGCCAGCCGGATCCGCTCGCCGGGTCCGGTGGCCGCCCGGTACTGCTCCAGA
TCGGCGGCGAGCGCGGCGAGCGCGGCGGTCACCGGCTGCCAGTGATCGGTTCCGGAGGTCAGCTGGAGCA
GCCGCCCGAGCGGATCCGGTTCCTGGTCGGCGAGCGGCAGCCGGGCCTCGATCAGGCCGGTCTCGATGAG
CTTGGCGACGAACTGCCGTACCTGCGGGTACGGCTGGCCACAGCGGCTCAGGAACTCCTCCAGCGAGCAC
TCGCCGAGGTCGGTCAGCAGGTCCAGGATGGCGCCGACAGCGGGCGTCAGGCGCAGGCGGCGGACGGCGC
CGCTCGGGGGGATGCCCAGGAAGCACACCTGGTCGCCGGTGCGCACCAGGCTCGGGTTCGGCCGGACCAG
CAGCAGTGCGTCGGGGGCGTCCGCGCGGGCCAGGGCGGCGGCGATGCGGTGCAGGGCCGCCGCGTCCGGC
TCGACGACCAGCCGTGCGGGGGCCGGGTGGGCACCGGCGGCGACCGGCCGCGCAGGGACCGGGTGGTCGC
CGTAGGCAGTCCGGGCAGGGCGGGTGGAGCGCCAGGTGGTGATGCCCGAGGCGGTCAGCGTGCTGCGCGG
GCTGGTCTTCGCCGCGGCTCTGGTGACGTATTTGGCCAGGCTCACGAGCTGGCGTTCCCGGGGCGGGCGG
GCGTCGCCGGCCAGCCACCCGGCCAGGCTCCGGTACAGGTTCGGCTGCACGTGCACGAGGGCGTCGCGCA
GCTCCGGACGGGCGGTCACGGCGCGCAGCTCTCGCATGGCCCCGGCCAGGTCGCCGGCCAGCAGCTCCGG
CAGGGCCGCCGTGGCCCGGGCCGCCTCCGAGCGCAGCCGCTCCCACTCCGTCACCCGCATGGCCGTCCCG
GCGGGCAGCGCCTCGGCCGCCGCGCGGAGCTCGCCCTTCAGTGGGAGCCCCCGATGGATCGCCCGGCGCA
GCGCCACGAGCAGGGGCTTGGAGCCGGTGGGCGGGTCGGTGCCGATGTGCTGGTAGAGCTCCCGCGACAG
CTCCTCGGCCAGCGCGGACAACTTCTCGTGCGCGCCCGCGATCTCCTCCGTGGCCCGGTGGGCGCGCTCG
CAGCGCAGCCGGTCCAGCACCGCCGCCTCCAGGCCCGCCGTACGGATCAC
 Primer design

Protein Sequence:879 a.a.
>ORF4|ThioFinder1118 Actinomadura melliaura SCC 1655
MIRTAGLEAAVLDRLRCERAHRATEEIAGAHEKLSALAEELSRELYQHIGTDPPTGSKPLLVALRRAIHR
GLPLKGELRAAAEALPAGTAMRVTEWERLRSEAARATAALPELLAGDLAGAMRELRAVTARPELRDALVH
VQPNLYRSLAGWLAGDARPPRERQLVSLAKYVTRAAAKTSPRSTLTASGITTWRSTRPARTAYGDHPVPA
RPVAAGAHPAPARLVVEPDAAALHRIAAALARADAPDALLLVRPNPSLVRTGDQVCFLGIPPSGAVRRLR
LTPAVGAILDLLTDLGECSLEEFLSRCGQPYPQVRQFVAKLIETGLIEARLPLADQEPDPLGRLLQLTSG
TDHWQPVTAALAALAADLEQYRAATGPGERIRLAASSTGHLEEAMKLAGLSPGRRAGRHPAAFDEHAILD
TPPAITLDDSWRQALADLSAFGALVALLDRNLPVRHCAAHYFTRRFGRTAEIPFVLFYEAISGDTEDPVA
AGLRLLRTMDPTEGGVVPLARLTASVSPRVREVARLRAGALETLRALRPGADGVVRIPPELAIKLGATAA
HLTGPPGAHAYYVQPCTGEDGLRLVLNSVAGAGGRGRTRVEQLAGRHRTRDEPPDNDPLVAQPPDDEPLI
AELSEDGPLVAELENLFDFTLNARSPAATHSIGYPSLSSTRRPGLVAPLGELTVSLDPITGLPVLRWPRL
RRQVVPPHTGVMSEIFLPPPARFLAEIFAPTPTVLFPNQNWLHDVGRAEPPRTVVHTPRVDLGRVTLLRR
TWAISAAEVPRRASGEEDARFLLRMERWRREAGIPAPCFVRILDVPSLRAGTGLFAKSRKPLYFDPANWF
LLLALDRDIRERPEEKALLFTEALPIPAGRVTEFLVEVS