Home 

Gene Symbol:  
ORF5
Organism:  
Actinomadura melliaura SCC 1655
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
6361..7851 [-1], 1491 bp
Product Function:  
NADH oxidase
Product Locus:  
 ABC02783.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1491 bp
>ORF5|ThioFinder1119 Actinomadura melliaura SCC 1655
ATGACCAGCTCCACGGACGCGGTAGCCACGGCGCGGCGGTTCTGGCACCGCTCGCTGGACGACTACGCCG
GTCTGCTGGGCTCCGGAGCCGGGCGGGAGGAGCCGTTGAAGACCAAGGTGTACGGCGACGCGAAACGCTA
CCCGTTGCCCGCCCGCGTGCCGTACGAGCTCGGGCCTCTGTCAGCCGCGCTCCGCCCGGCCGCCGGGCCG
AGCCTCCAGACGACCGCCGGGTGGGGGCGGCTGCTGCGGTACGCCTACGGCCTGTCACGCTCCCACCTGG
GTCCCCTGGCCATGTGGCCGTTGCACCGGACGGTGGCCTCGGCGCGTTGCCTGTTCCCCGTCGAGCTGTA
CGCCTGGCTCCCCGGAGACGGCGAACGCCCCGCCGGACTGTTCTACTACGACCCCGCCCACCACCACCTC
GTGCTGATCCGCGAGGGCGACTGGCGCTTCCGGCTGGCCGCGACCGGCGCCGAGGCGGTGTTCGTCCTCA
CCTCCCTGTTCATCAAGACCGCCTTCCGCTACGGCGACTACGCCTACCGGTTGTGCGTGCAGGAGGCCGG
CCTGGTCGCGGGCAACCTGCTCATGGTCGCCGGCGCGCTCGGGCTCACCGGCCGGGTGAGTCACCGCTTC
CCGGACGCCGCGGTGCAGCGGCTGCTCGGCCTGACCGCGCCCGGAGAGGCGCCGCTCATGATCATCTCTG
TGGGCTCCGGATCGGGTGAAGCAGCGTCGCGTACGGCTCCCGCCGCGGTCGCTGACGGCTATGTCTCCCC
GCTGGACCTGCGCGACTGCCCGGAGCTGCTGGCTCTGGACAGTGCGTCGCGGCTCACGGACGCGACCCAG
CCCGAGCTCCCCGCCCCCGGCGGCGGCCCCGCGACGCGCACGGCCGACATGCCGGCGGAGCGCGACCCGG
ACCTGGCAGACGTGCTGGCCGCGCGCGAGTCGGGCGGGCCGGTCTTCAATTCGGTCGCCCGCCCTGCGGA
TCCTGCGGTCCTGCGGTGGCTGGCCACCCACGCCGACGGCACCCACACCTCGGACGCCTCCCACGGCGAC
CCGCTCGTGCGAAGTTACGTCGTGGTCAACGCGCTCGACGGTGTGGCACCCGGCCTCTACCGCCTGGCGG
GCGGCACGGCGGACCGGGTGGCCGCCGGCCACCTCGCCGGACCGCTCATGCAGGTGCAACCGGACTGGCC
ACCGCCGATCAACTTCCACTCGGCGAACCTGGTCGTCTACGTGAGCGCCGACCCCGAGGCCGCGATGGCG
CTCTTCGGCGCCAGGAGCTACCGGATCCTCCACCACGAAGCCGGGATCGTGGCCCAGCGGGTGAGCGTCA
TGTGCACGGCGCACGGCCTGACGGCACGGGTGCACAACGGCTACCTCGCCCGTCCCCTCCGCGAGGCCCT
CGGCCTTCCGGAGAACCAGACCGTCCTCTTCCAGATCGCCGTCGGCACCGCGCGTCCCACGGGCGTCTAT
CGCCTGCCGATCAGTTTCTAG
 Primer design

Protein Sequence:496 a.a.
>ORF5|ThioFinder1119 Actinomadura melliaura SCC 1655
MTSSTDAVATARRFWHRSLDDYAGLLGSGAGREEPLKTKVYGDAKRYPLPARVPYELGPLSAALRPAAGP
SLQTTAGWGRLLRYAYGLSRSHLGPLAMWPLHRTVASARCLFPVELYAWLPGDGERPAGLFYYDPAHHHL
VLIREGDWRFRLAATGAEAVFVLTSLFIKTAFRYGDYAYRLCVQEAGLVAGNLLMVAGALGLTGRVSHRF
PDAAVQRLLGLTAPGEAPLMIISVGSGSGEAASRTAPAAVADGYVSPLDLRDCPELLALDSASRLTDATQ
PELPAPGGGPATRTADMPAERDPDLADVLAARESGGPVFNSVARPADPAVLRWLATHADGTHTSDASHGD
PLVRSYVVVNALDGVAPGLYRLAGGTADRVAAGHLAGPLMQVQPDWPPPINFHSANLVVYVSADPEAAMA
LFGARSYRILHHEAGIVAQRVSVMCTAHGLTARVHNGYLARPLREALGLPENQTVLFQIAVGTARPTGVY
RLPISF