Home 

Gene Symbol:  
ORF6
Organism:  
Actinomadura melliaura SCC 1655
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7848..9704 [-1], 1857 bp
Product Function:  
hypothetical protein
Product Locus:  
 ABC02784.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1857 bp
>ORF6|ThioFinder1120 Actinomadura melliaura SCC 1655
ATGAACCGGCAGCCGGACGGAGAGCCGCTGCGCCGAGCGGTCGCGCACCGGCTGTCCGGCAGGCGGGAAA
CCCTCGACGGCGAGCCCCACCTCGCCGTCCACGAGGCCACCGGCCTGGCAGCCGAGACGATCGGGGCCCG
CATGAGCGCCGAACCCGGCCCCATCCTCTGGCTGAACGAAGACGACCAGGGGTTCTGGATCGGCCCGGCC
ACCCGCAGCGGCCGGCCGGGCTGCCCGGAATGTGTACGGCGGCGCAACCTGGCGATGCGGACCGCGACCG
GCGCCCCGCGGAGCCGTCCGCGCCCGAGACCCGCCCTCGGGCTCGCCCTGCTGACAGTCGCGGCCCTGGC
CGAGACGCGCCTGACCGGCCTGCGCGCGGGAGCCGTACCGGATGATCTGCTCCGGCTCGACCCCGACACC
CTCGAAGTCAGCCGCCACCCCCTGCTGCCCGATCCGACCTGCCCGCTGTGCGGAGGATTACCCGCCGACA
CTCCCGAAGCCGCCGCCATCACGCTGGTCTCCCGCCCGAAGCCCGGCGTCGAGACCTTCCGGGCCCACGA
GGTGGACGCCGCCGAGCTGCGCCGCCGCTTCGTGGACGACCATCACGGGGTGGTCGGCCGCCCCCGGGTG
GACGAGCTGGTGGCCTTCCCCACCTCCGGGGCTCCCGTCGGCGTTCCGGGCCGGCCCACGGGGGAGATGG
GGTACGGCCGCGCCCTCGACCACGGCAGCGCCGAGCTCGTCGCCATCCTGGAGGCACTGGAACGCTTCGG
CGGCATCCGTCCCGGCGGGCGGCGGACCGTGGTCACCGCCTCCTACGCCGAGCTCGCCGGCCGGGCACTC
GACCCCCGCACTCTCGGGCTGCACGACAGCGCACGCTACGACTCCCCCGGCTTCCCCTTCCGGCGCTTCA
CCGAGACGGCCAGGTGCGACTGGGTCTACGGGCACTCTTTCGCGCGCGGCGGCGCCGTCCTGGTGCCGGA
GAGCTACGCCTACTACGGCCTGCACCGCCACGGGGCCGACCGCCCGTTCGTCTACGAGATCTCCAACGGC
TGCGCGCTCGGCACCTGCCTGGAGGAGGCGATCCTGCACGGACTGCTGGAGGTCGCCGAGCGCGACGCCT
TCCTGCTCGCCTGGTACTCCGGCGCGACCCCGCCGACGATCGACCTCGACGCGACCGGAGACCCCCGGAT
CCCGCTGATGGTCACGCGCCTGCGCCAGCTCACCGGCTACGACGTCCACGCCTTCGACATCACCGCGGAA
CAGGGCGTCCCCAGCGTCTGGGCCCTGGCCACAGCGCGGCCCGGCCGACCGGACCTCCCGGCCGCCCTGT
GCGCGGCCGGTTCGGCCCTGCTGCCCGGCAAGGCGGTCAGGGCGGCGCTGCACGAGCTGAGCACGATGGT
CGAGGCCCACCGGGACAGCTACCCCGGCGAGCGGGAACGCGCCGCGCGCATGGCCGACGACCCGGAACTG
GTCACCGAGATGAAGGATCACGCGCTGCTCTACTGCCACCCGACGGCCGCCGAACGGCTCTCCTTCCTCT
TCGGTGGCCCGGTCGCCGGGCCGCCGCCCGCCTGGCCGGCCCACGACGACCTGCGGGACGACCTGGCGGA
GATGATCCGGCGCTACCTGGACTCCGGCCTGGACGTGGTGGTCGTGGACCAGACGACGCCCGAACACCGG
GCCGCCGGACTGGCGTGCGTCAAGGTGATCGTGCCCGGCGCCCTGCCGATGACCTTCGGCCACGCGAGGC
GGCGGGTGGCGGGGCTGACCAGGATCTCGACCGTGCCTGCCCGGCTCGGCTGGAGCTCGACGGCGTACCC
GGCCGAGCCGAACCCCGACCCCCATCCGTTCCCATGA
 Primer design

Protein Sequence:618 a.a.
>ORF6|ThioFinder1120 Actinomadura melliaura SCC 1655
MNRQPDGEPLRRAVAHRLSGRRETLDGEPHLAVHEATGLAAETIGARMSAEPGPILWLNEDDQGFWIGPA
TRSGRPGCPECVRRRNLAMRTATGAPRSRPRPRPALGLALLTVAALAETRLTGLRAGAVPDDLLRLDPDT
LEVSRHPLLPDPTCPLCGGLPADTPEAAAITLVSRPKPGVETFRAHEVDAAELRRRFVDDHHGVVGRPRV
DELVAFPTSGAPVGVPGRPTGEMGYGRALDHGSAELVAILEALERFGGIRPGGRRTVVTASYAELAGRAL
DPRTLGLHDSARYDSPGFPFRRFTETARCDWVYGHSFARGGAVLVPESYAYYGLHRHGADRPFVYEISNG
CALGTCLEEAILHGLLEVAERDAFLLAWYSGATPPTIDLDATGDPRIPLMVTRLRQLTGYDVHAFDITAE
QGVPSVWALATARPGRPDLPAALCAAGSALLPGKAVRAALHELSTMVEAHRDSYPGERERAARMADDPEL
VTEMKDHALLYCHPTAAERLSFLFGGPVAGPPPAWPAHDDLRDDLAEMIRRYLDSGLDVVVVDQTTPEHR
AAGLACVKVIVPGALPMTFGHARRRVAGLTRISTVPARLGWSSTAYPAEPNPDPHPFP