Home 

Gene Symbol:  
ORF7
Organism:  
Actinomadura melliaura SCC 1655
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
9701..11710 [-1], 2010 bp
Product Function:  
hypothetical protein
Product Locus:  
 ABC02785.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2010 bp
>ORF7|ThioFinder1121 Actinomadura melliaura SCC 1655
GTGAGCGTGGACAGGATGCGGCCCAGACTCAAGGCAAGCGCCTTCTATGTGCCGGTCGAGGGGGGTGTGC
ACTTCCAGAGCGGCAACCGCAGCGTGCTGACCCTGCGTGGCTCCTCGCTGCACGCCTGGCTGGATCGGAT
CACGCCCCTGCTCGACGGAACCCACCTGCTGGGCGAGCTGACCGCCGGCCTGGGCGAGGAGCGGAAGGCG
ATGGTCGTCGACCTGGTCGGCGCCCTGCACCGGCACGGCCTGGTCAAGGATCTGGCCACCGACCGGCCGC
ACGGGCTGACCCCGGCCGAGATCGCCACGTACGCCGCCGAGATCGCCTTCGTCGACGAGTTCCAGGACTC
CGCCGAGCACCGCTTCGAGCGATACCGGACCTCCCGCGCCGTGCTCGTCGGCGCCGGGCTCACCATGGAG
TCGCTCGTCCACTCCTGCCTGCATTCCGGCCTACGCGACATCCGCGCCTTCGTCAGCCCGGAGGTCCCCA
CGGATCTCGGGCTGCTGGACGAATACGCGCGACGAGGGCGAGATCGTGACCCCGCGCAGACCATCACCGT
CGAGCCGCTGCCCGGCTCCGGCCCGGCGGCCCTGCGTGCCCTGGCCTCGGCGGGTGACGTTGTGCTGCAC
GTGAGCGACCTGCCTTCGCCCGAGCGGGCGGCGCAGCTCGACGCCGCGTGCGCGGCGGCCGGAGCCGACT
TGGTGCAGGCCGTGGTCACCGGTGACGAGGCCTGGATCGGCCCGGTTTGCCGGTACGGCGAGGCGCACCT
GCGCTGGGCGGCAGTCTGGAACCGGCTGACCACGCGCCCGCTGCCCGGCACCGGGCCGAGCCGGTACCTC
AGTGGGCCCACCGCCTCGTTGGTCGCCAACCACGTGGTCTTCATGTGCTTCAGGGATCGCACCGGAGTCG
CCGAGCCCGGGCCTGCCGTACGGCTGGAGCTGGAGACCCTGCGCACCGGAAGCCATCGCGTGGTCCCGTA
CGCGCCCGTGGCCTTCTCCGGGGAAGGCGTCGAGGCAAGGCTGCGTGAGCTGGACGAGGGGCCGGAGGTG
GGCGACGAGGAGTTCGCCGCGCGGGTGACCACGCTGATCGACGATCGGCTCGGCGTGCTCGACCTGGTGA
CTGAGGACGGTCTCGAGCAGTTGCCGCTGCGGGTGTCGAAGGCGGTCGTGACCGTTCCCGGCGACGCGGC
GCCCGTCGAGGTGTACGGCGCTGCACTCGACCTGACGACGGCTCGCTGCAGGGCGGCGAGGGACGCTCTG
GCGCGCTACGCCGCTGCTCCGGGGCACGTCGGTGCCGGGGATGACAACCCCGCATCCGGTAGGCCCTTCG
GCGGCCCGCGTCGGGGGGTACGGCTCGCCGACGGGCATGTCGTCGAGGTGACCGGTCCAGCCTCGATCGT
GGCCGCCGAGGCCACCTGGGCCGACGCCGTCGAGCAGGCACTGCTGACCGCCTGCGCCGACCTGGCAGCC
GATCTGGCCGCAGACGTGGCCGGCGAGCCGTCGCCGAGCGCCGGGCGGCGTTTCCCCGGAGTGGCGCTCC
GCGACGAGCTCCTGGACGAGCAGGCCCGGCGCTACCACGAACTGCTCCTGGCCGGCGGGGAACGCTGTCA
CATCTACGATCTCGGGGAGCTGCTCGACCTCCCCCTCTACGCATTCGGCCTCGGCGGCCGGGTCGTCCAC
TACCGGGCCGGCGTCACCGGCGCGGACGCGATCCGGGACGGGCTGGAGTGCCTGCTGCTCGACCTCCAGG
CCCGCCTGACCGGCCTTCCCGAGCTCAGCCGCCCCGCCCGCACGGACCTGCCGGAGCGGGTGCGCGGCGC
GGAGCCGGACGACGCCCCCGCCTCAAGGGACCTGCTCGGCGACCCGGCCAAGAGGCGCCAGGTCATCGCC
GCCCGCCTCGCCGATCACGGCCGCCACCTGGCCGTCGTGCCGCTGCACGCCGATCCGGCGGTCACCCGTG
TCCTGCCGTACCTCGCCGGCCTGACCCCGTGCGACGGGACGGCCCGATGA
 Primer design

Protein Sequence:669 a.a.
>ORF7|ThioFinder1121 Actinomadura melliaura SCC 1655
MSVDRMRPRLKASAFYVPVEGGVHFQSGNRSVLTLRGSSLHAWLDRITPLLDGTHLLGELTAGLGEERKA
MVVDLVGALHRHGLVKDLATDRPHGLTPAEIATYAAEIAFVDEFQDSAEHRFERYRTSRAVLVGAGLTME
SLVHSCLHSGLRDIRAFVSPEVPTDLGLLDEYARRGRDRDPAQTITVEPLPGSGPAALRALASAGDVVLH
VSDLPSPERAAQLDAACAAAGADLVQAVVTGDEAWIGPVCRYGEAHLRWAAVWNRLTTRPLPGTGPSRYL
SGPTASLVANHVVFMCFRDRTGVAEPGPAVRLELETLRTGSHRVVPYAPVAFSGEGVEARLRELDEGPEV
GDEEFAARVTTLIDDRLGVLDLVTEDGLEQLPLRVSKAVVTVPGDAAPVEVYGAALDLTTARCRAARDAL
ARYAAAPGHVGAGDDNPASGRPFGGPRRGVRLADGHVVEVTGPASIVAAEATWADAVEQALLTACADLAA
DLAADVAGEPSPSAGRRFPGVALRDELLDEQARRYHELLLAGGERCHIYDLGELLDLPLYAFGLGGRVVH
YRAGVTGADAIRDGLECLLLDLQARLTGLPELSRPARTDLPERVRGAEPDDAPASRDLLGDPAKRRQVIA
ARLADHGRHLAVVPLHADPAVTRVLPYLAGLTPCDGTAR