Home 

Gene Symbol:  
ORF2
Organism:  
Actinomadura melliaura SCC 1655
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1740..2858 [-1], 1119 bp
Product Function:  
unknown
Product Locus:  
 ABC02780.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1119 bp
>ORF2|ThioFinder1116 Actinomadura melliaura SCC 1655
ATGGACAAGCCGACCGAGTGGCACAGCGTCCACGTCCACTACTACGAGCCCGACTTCTACCCGCTGGTGC
TCGATGCCGTACAACCGCTCTTCACACACCTGGCCACCCCTGCCTACTTCGTCCGGCACTGGCGGCGCGG
CGACCACCTGCGGCTGCAGATCCGGGCCGATCGGGACTGGTTCGACGAGGTCGCCCGGCCCGCCGTCGAC
GGCACCGTGGGCGCCTACCTCGAGGAGCACCCGTCCAGAGCCCGGATCGACGAGCGGCTGCTGCTGGCCG
CCCACCGCGAACTCGCCCACACCGAGCAGGACAGCGGACCGCTGTGGCCCTTCCGCCCGGACAACAGCAT
TCACCACCAGCCCTACGACGACCGCGCCGAGGTGCTCGGCAGCCGGGCCGCGGTCGAGCTGTTCGCCGAC
TTCCACGTGGCAGTGATGCCGATCACCTTCGAGACGATCGCGGCCGTGCGGACCGGCGTGTCACGCATGG
TGCTCGCTCTCGACCTGCTTCTCGCCGTCGCCCATGCGCGCTGCGCGGACCCGGAGGGCGGCGGGATCAG
GCGGGGATTCGTCTCGCTGCGTTCCCACGCGGACGCCATGATCGCTTCCACTCCCGAGCCTGAGGCGACC
CGAGCCCTGCTCGACGCCCAGTACTCGCGGCATCGCGCCTACCTCACGCGGCGCCTGCGGCAGGTCGTCG
CGGCAGCCGACGGCACCGGTCCCGCCATCCCGTTCGTGCGCGACTGGCTGGCCGCCACCGAGCCGATCTC
GAACCGCTGCGCGCAGCTGATCCGCTCCGGCGAGATCGCGGCGACCGAGCACGAGCGCCAGGACGAGAAG
TGGGACTGGGCCGGGATTCGCCACAGCCGGCTCCACCAGCTCATCTACGCCAACGACGCCTACCGGGACT
TCCTGTGGGCCGAGCCGTGGTTCCACCACTACCGGCTCATGCTGAACCAGCTCTACCTGCACCTGCACCG
GCTGGGCTGCTCCGCCGTCGAGCGCTTCCAGCTCTGCCACCTCGCCGCCTGTGCCGTCGAGGAGGTCTAT
GGCCTGTCCGCTCTGGAGCACGTCGAGCGATATGTGCGTGCCCATCCCAACTCGGGCGCGCGTACGTGA
 Primer design

Protein Sequence:372 a.a.
>ORF2|ThioFinder1116 Actinomadura melliaura SCC 1655
MDKPTEWHSVHVHYYEPDFYPLVLDAVQPLFTHLATPAYFVRHWRRGDHLRLQIRADRDWFDEVARPAVD
GTVGAYLEEHPSRARIDERLLLAAHRELAHTEQDSGPLWPFRPDNSIHHQPYDDRAEVLGSRAAVELFAD
FHVAVMPITFETIAAVRTGVSRMVLALDLLLAVAHARCADPEGGGIRRGFVSLRSHADAMIASTPEPEAT
RALLDAQYSRHRAYLTRRLRQVVAAADGTGPAIPFVRDWLAATEPISNRCAQLIRSGEIAATEHERQDEK
WDWAGIRHSRLHQLIYANDAYRDFLWAEPWFHHYRLMLNQLYLHLHRLGCSAVERFQLCHLAACAVEEVY
GLSALEHVERYVRAHPNSGART