Home 

Gene Symbol:  
SVEN_5138
Organism:  
Streptomyces venezuelae ATCC 10712
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5549075..5550001 [1], 927 bp
Product Function:  
hypothetical protein
Product Locus:  
 CCA58424.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:927 bp
>SVEN_5138|ThioFinder680 Streptomyces venezuelae ATCC 10712
GTGACCCCGACCCCGCCCACCACGCCACGGCGGACCGCATGGACCGCCTGGCACCTCCACCTCGGCACGA
CGGCCCGGTCGGCACACGACCGGGTCGTCACCGATGTCATCGGCCCCACGATCCGCGAACTCCCCCCCGG
CACACCGTGGTTCTTCATCCGCTACTGGCAGTCCGGCCCCCATCTGCGCCTGCGCGTCGGCGACCTCGAC
GACGCGGCGCGCGCCCGCGTGGCGGCCGCCCTCGCCGAACGCCTCGCCGTCGCCGGCGCGCCCGCCGAGG
GCGAGGAGCCGCTCGACCCCGCCGCCTACCGCAGCGGGGCCGAGCGGCTCGCCGCCGCGGGCGAGACCGG
CGAGAACACCTCGGTGAAGGCCCTGCTGCCCCCCGGCGTCCACCCGGCCGTCTACGAGCCGGAGTACGAC
CGGTACGGCGGCGCGTCCCTGATGCCCGCCGCCGAGTCCCTCTTCGAACTGTCCAGCGCCCTCGTCCTCG
CCGCCCTGCCCCGGGTCACCGGCGAACGGCAGCGGGCGACGCTCGCCCTGCGCGGCACCGTGGCGGTCGC
CGCGGCCCTCGGGGACCCGGCGGAGCGCGCGTACTACTACGCCCACGGGCTCGGCGCCTGGCGCGCCTGG
GCCGCCGAGGCCGGGCACCCGGCCGGACTCCTCGACACGATCACCCGGGTCGAGGGGACGGTCGCCCTCG
ACCCGGCGGCCCACGGCCCGTTCGCCGGCTGGCACGCCCGGATCGCCGCCCACGCGGAGGAGATCCGGGA
GCAGTCCCCGTCCCACCCCGGCATGGTCCTCTTCTCGCACGCGCACATGCTCCACAACCGGCTCGGCCTG
AGCCTCCTGGAGGAGCTGCGCACCTACGCGGTCCTGGCCCACGCGTTCCCGCTGCCGGCGAACACCCCCG
TACCGCAGCACGCTTGA
 Primer design

Protein Sequence:308 a.a.
>SVEN_5138|ThioFinder680 Streptomyces venezuelae ATCC 10712
MTPTPPTTPRRTAWTAWHLHLGTTARSAHDRVVTDVIGPTIRELPPGTPWFFIRYWQSGPHLRLRVGDLD
DAARARVAAALAERLAVAGAPAEGEEPLDPAAYRSGAERLAAAGETGENTSVKALLPPGVHPAVYEPEYD
RYGGASLMPAAESLFELSSALVLAALPRVTGERQRATLALRGTVAVAAALGDPAERAYYYAHGLGAWRAW
AAEAGHPAGLLDTITRVEGTVALDPAAHGPFAGWHARIAAHAEEIREQSPSHPGMVLFSHAHMLHNRLGL
SLLEELRTYAVLAHAFPLPANTPVPQHA