Home 

Gene Symbol:  
SVEN_5134
Organism:  
Streptomyces venezuelae ATCC 10712
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5541076..5543805 [1], 2730 bp
Product Function:  
hypothetical protein
Product Locus:  
 CCA58420.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2730 bp
>SVEN_5134|ThioFinder676 Streptomyces venezuelae ATCC 10712
ATGACCGCCCCCGTGATCGGCAGCCCGACGGACCCGCGCGGGGCCACACCGCCCGAGCCCGCGACCGTAC
CGCCGCCCACCGCGACACCCGTACCGGCCGCCGACGCGACGACCGCGCAGACGCCCGCCCCGACCCCCGC
CGCCGGCCCCCCGTCCGCCCCAGAGCCCCTCTGGTTCCTGCGGGTCAACCCGCTGCGCCGGGCCCGGCTC
GCCGACGCCGAGCTGCGGCGGCAGCTCGTCCTCCTCACCGCCGCCGAGCAGACCCTCGCCGAGGCCTCCG
CCGCCGCGTCCGACGAGCTGTACGAGCGGATCGGCGCCGCCGCCGACGACGCCGAACGACGCGAACTGAT
CGCCCTGCGCCGGGCCGTGAACAGCGGCAAGGCCCCCAAGAAGACGCCCGGGCCCGCCTCCCCGGTGCTC
GACGCCTGGCTCCGGGCCCGCCAGGAGCGCGACCGGGTCCGCGCGGAGCTCGTCGCCGGCTACCCCGACG
CCGCCGAGCGCGAGCGCGGCGTCCTCGCCGAACTCCTCGGCGACCCCGACCTGCTGCGCTCCCTCGCGCT
CGTCGCCCCCGAGGTCCACCAGGAGGCCGAGCGCTACCGCGCCGCCGTCCGGGCCCCCGGCAAGGTCCCG
GCCAAGTCCCGCAAGTCCGAGCGCGGACTCATCCAGTACGTGACCCGTGCCATGGTCCGTACGAGCCCGC
TCGCCCGCTTCACCGCCGTCGGCATCGCCGAGCCCGACCCGGCCGCTTCCGGCCCCGACGAGGCCGGCTT
CCCGGGCGCGACCGCCTTCCCCGGCCTCGACCGCGTGATGCTCAACTACGTCCTCGGCGGACTGCCGGAC
CCGGCGGACCGGGCGATCGAGGACATGTGGATCGGCCTGCCGCCGACCTCCGCGCCCGACCCGGCGGCCG
GCAAGCTGTTCTTCCTCAAGCCCTCGCCCGAGGGGATGCGGCGCGCCGCCGTCGCCCTCGACGGCCCGGC
CGGTGACCTCCTCGACGCGGTCTCCATGGGCCCCCGCCCCTTCCCGTCCGTCGTCGCCCACGTCGCCGAA
CGCTCCGGCATCGCCGCCGAGGACGCCGACCAGAAGGTCCGCGGCGCCGTCGCGCAGGGCCTCCTCTGCA
CCTTCCACGCGGCCGAGGACGGCTCCACCGACTACGACGTCCTGCTCACCCCGGACGACCCCCGTCCGGT
CACGAAGCGGCTCACCGACCGGGTCAAGGCCGGAATGCCCGCCTTCACCGCCGCGCCCGCCGACGAACGC
GGCGCCGCCCTCGCCGAGTTGCGCGGCGCCCTCGGCGAACTCAGCCACGCCGCCGGCCGCCCCGCGCACG
TCACGGTCGAGGAGGACTACGTGATGCCGCCGCTCAAGGTGGCCACGGAGCCCTGGAAGGAGTCCCTGAA
GGACCTCGGCCCGGCCGTCGAACTCCTCACCGTCTTCGACTGGCTGCACGACGTGCGGGTCCTGATGACA
GCCGCGTTCGTCGAGCGCTTCGGCCCCGGCGCGAACGTCCCGCTCGCCGCCCACGCCCCCTTCGTCGTCG
GCGAGGTGTCCCGCCGCGCCGCCGCCATGGCCGCCGTGTACGGCCCCGACGGCCCCGGCGACCCGACCGC
CCTCAAGGGCATCGGCCCCGCCGACGGCTCCCTCGAGCGCATCTACGAGCTGCGCCGCGAGGTCACCGAG
GAGCTCCACGCCCTCATCGGCGGGGCCGTCGAGCGCGGCGACGACACCCTCCGGATCAGCCCGGAGCAGG
TCGCGGGCCTCACCGGCGACCTGCCGGAACGATTCCGCCGCGACCCGCTGATCTACGGCATCCTGCTCCA
GCGCGGTGACGGCCACCTCGTCCTCAACGACGGACTGCCGGGCCACGGCATGCTCTACGCCCGCTTCCTG
GAGGCCGACCGGCGCCTCGGCGGCCGCGCCCTGCCCCGCCTCGCCGAGCACGTACGCCGGGTGTACGGCT
ACGACGGCGCCCGCGTCACCGAGGACCTGGGCCTGCACCGCCTCAACGTCAACGCCCACACCCCGATCCT
GCCCGGCGGCCTCACCCCCGACGACTGGTTCGGGCTGCGGCTCGCCCACGACCCCGAGACCGACTCGCTG
CGCGTCGAGGACGCCGACGGGGCCCCGCTGCGGGTCCTGCCGCTCGGCACCGGCCACCCCGGCCTCTTCC
CGCCGCCGCTCTCCGTCGCCTCCGGACTCGCCATCAGCGGCCGCCTCTTCAACGCCCTGCCCAACAGCTG
GCACGCCGCCACCCCCTGGGACAGGGCCACCACCCGCACCGCCCCCCGCATGGCCGTCGGCGACGTCCTC
ATCGGCCGCCGCCGCTGGTACGGGGGAGAGGAACTCGGCGCCGCCCTCGCCGCCGGGCCCGAGGAGCACG
AGCGGCTGCTCGCCCTCAACGCCTGGCGCGCCAAGTACGGCGTCCCCGAGGAGGTCGTCGTCAAGACCGT
CCCCGAGGACGAGGGCCCGCTCTCCGTCGGCGCCCCCGACATCCAGTCCAAGCGCCTCCAGCAGAAGCCC
CAGTACGTGGACCTGAGCAGCGCGCTCGGCGCCCGCGTCCTGCCCCGGATGCTGGAGCGGCGCGGGGCCG
ACACCGGCGGCAGCTACCTGGAGGAGGCGCTGCCCGGCGTCGTCGACGGCAGCCACGCCACCGAGTGGGT
CGTCGAGGTCGGCCGGACCGCCGGCGGCCGCTTCACCTACCACCCGAGCACTCAGGCAGAGGAGCGGTGA
 Primer design

Protein Sequence:909 a.a.
>SVEN_5134|ThioFinder676 Streptomyces venezuelae ATCC 10712
MTAPVIGSPTDPRGATPPEPATVPPPTATPVPAADATTAQTPAPTPAAGPPSAPEPLWFLRVNPLRRARL
ADAELRRQLVLLTAAEQTLAEASAAASDELYERIGAAADDAERRELIALRRAVNSGKAPKKTPGPASPVL
DAWLRARQERDRVRAELVAGYPDAAERERGVLAELLGDPDLLRSLALVAPEVHQEAERYRAAVRAPGKVP
AKSRKSERGLIQYVTRAMVRTSPLARFTAVGIAEPDPAASGPDEAGFPGATAFPGLDRVMLNYVLGGLPD
PADRAIEDMWIGLPPTSAPDPAAGKLFFLKPSPEGMRRAAVALDGPAGDLLDAVSMGPRPFPSVVAHVAE
RSGIAAEDADQKVRGAVAQGLLCTFHAAEDGSTDYDVLLTPDDPRPVTKRLTDRVKAGMPAFTAAPADER
GAALAELRGALGELSHAAGRPAHVTVEEDYVMPPLKVATEPWKESLKDLGPAVELLTVFDWLHDVRVLMT
AAFVERFGPGANVPLAAHAPFVVGEVSRRAAAMAAVYGPDGPGDPTALKGIGPADGSLERIYELRREVTE
ELHALIGGAVERGDDTLRISPEQVAGLTGDLPERFRRDPLIYGILLQRGDGHLVLNDGLPGHGMLYARFL
EADRRLGGRALPRLAEHVRRVYGYDGARVTEDLGLHRLNVNAHTPILPGGLTPDDWFGLRLAHDPETDSL
RVEDADGAPLRVLPLGTGHPGLFPPPLSVASGLAISGRLFNALPNSWHAATPWDRATTRTAPRMAVGDVL
IGRRRWYGGEELGAALAAGPEEHERLLALNAWRAKYGVPEEVVVKTVPEDEGPLSVGAPDIQSKRLQQKP
QYVDLSSALGARVLPRMLERRGADTGGSYLEEALPGVVDGSHATEWVVEVGRTAGGRFTYHPSTQAEER