Home 

Gene Symbol:  
SVEN_5137
Organism:  
Streptomyces venezuelae ATCC 10712
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5547498..5549063 [1], 1566 bp
Product Function:  
hypothetical protein
Product Locus:  
 CCA58423.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1566 bp
>SVEN_5137|ThioFinder679 Streptomyces venezuelae ATCC 10712
GTGACGGCCCCGACCGCCCCGCGTGCCGCATCCGGCGACTCCGCCGCGGCCGGGGCGTGGACCCGGCGCG
GCCCCGTCGACCTGCCGGGACCCGAGGGCGACAACAGCATCGCCCGTGAGCCCCTCTGGTACGCGTACGG
GGCCGGGGACGACGCACCGGAGGCGCCCCCGTGGACCTGGGTGCCGCAGCCGCCGCCCGACACCCACGTA
CCGCCCCCGCCGCCGCGCGGGGGCGGCCCGCGCGAGCCCCTGCCGCTCGGCACCCACGACCGTCTCGCGG
GGCTGCCGTACCCGGCGCTGCCGGGCCCCCTCGGCAGCGCCGACCGNNNNNNNNNNNNNNNNNNNNCCTT
CGGACCGCAGCGCAGGGAGCCCGAGAACCCCTACAACGACCACCGGCCGTACGCCTCGCCGCGCTGCCTC
TTCCCCGTCCACGCCTTCGTGGACGGGGGCGCGGGCATGCCGTGGCGGCTTCTGGAGCCGGACCGGCACG
CCCTCACCGGCGCCCCGGCCGCCCCCGCCCGGAACGTCGTGCTCACCGGCCGGTACACCAGCGTGCCGCC
CGCCTACCAGTGGTTCCGCGGTTCGCTCATCGCCATCGAACTCGGCTTCGTGCTGCGGTCGTTGAGCCTG
GGCCTTGAGCTGTTCGACGTCCCCGCGCGGCTGCGGCCGCCCGGGCGGGACGCCCACCGCCTGCTGCCCG
CCCTCGGCCTCGACGACGCCTGGGCCTGGTCCCTCCCGTTCGTCGTGGAACTCGACGGCGAGGAGGGCCA
CGCGCCCCCCGAGCCGCCGGCCCTGGCGGGACACGCGCCCACCGAACCCCCGGACCACCTGCCCCGTACC
GACCCCGCCCTCGCCGCGCTCATCCGCGTCAACCGCGAGCAGACCTACGACGGCGCCGCCGCCCCGCTCA
CCACCGCCGTCCCGGCGGACCTCGCCCCCTCCGCGATCGCGCCGGACTGGGCCGAGCTGCTGTGGCGGCG
CCACTCCGGACGCATGCCGCGCGCCCTGCACGGCATGAGCGGCCGGCGCCGTACGGTACCCGCCGAGGCC
CTCGACAGCGCCGCCCGCTGGCTCTCCGTCCCCCCGCCGGGACCCGAACTCGCCGCCGCCTTCGAGGCGT
TGAAGGTGACCGCGGTCGTCCAGGGCGTCACGGGCCGGACCGACGGCGTGCACCTGCTGCGGGACGGCGC
CGCCCACCTGCTGCGCGCCGACCCGACCGCGCCGCGACGCCTGGAGGAGCGGTACGGCTACGGCCTCTCG
CCCGTCAACGGCTGCGGCATCCACGACGCGCCCCTCACCGTGTTCCTGTCCGTACGGACCCGGGAGCTCT
TCGAGCGCCTCGGGACCGCCGGCTGGGGCGCCGTGCAGCACGCCGCCGGCTGGGCCGCGCACGGACTCTG
CCTGTCCGCCGCCGCCTCCGGCCTCTTCGCCCGCCCCGTGCGGGCCTTCAAGGAGATTCCCACCCAGCGC
GTCCTCGGCCTGGACCCCGACGAGATGATCGTCCTGTCCGTGGTCGTGGGAGTACCGCAGGACACCGGCG
GCGCGCTGCTCGACCTCAGACTCTGA
 Primer design

Protein Sequence:521 a.a.
>SVEN_5137|ThioFinder679 Streptomyces venezuelae ATCC 10712
MTAPTAPRAASGDSAAAGAWTRRGPVDLPGPEGDNSIAREPLWYAYGAGDDAPEAPPWTWVPQPPPDTHV
PPPPPRGGGPREPLPLGTHDRLAGLPYPALPGPLGSADRXXXXXXXFGPQRREPENPYNDHRPYASPRCL
FPVHAFVDGGAGMPWRLLEPDRHALTGAPAAPARNVVLTGRYTSVPPAYQWFRGSLIAIELGFVLRSLSL
GLELFDVPARLRPPGRDAHRLLPALGLDDAWAWSLPFVVELDGEEGHAPPEPPALAGHAPTEPPDHLPRT
DPALAALIRVNREQTYDGAAAPLTTAVPADLAPSAIAPDWAELLWRRHSGRMPRALHGMSGRRRTVPAEA
LDSAARWLSVPPPGPELAAAFEALKVTAVVQGVTGRTDGVHLLRDGAAHLLRADPTAPRRLEERYGYGLS
PVNGCGIHDAPLTVFLSVRTRELFERLGTAGWGAVQHAAGWAAHGLCLSAAASGLFARPVRAFKEIPTQR
VLGLDPDEMIVLSVVVGVPQDTGGALLDLRL