Home 

Gene Symbol:  
SVEN_5136
Organism:  
Streptomyces venezuelae ATCC 10712
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5545573..5547501 [1], 1929 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 CCA58422.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1929 bp
>SVEN_5136|ThioFinder678 Streptomyces venezuelae ATCC 10712
ATGCCCACTGACACCCTCGCGATCTCCCTCGCCCTCGGCCCCGGGCTCGACGCCCACCCCGCCGACGAGG
ACTGGCGCTCCGTGCTCGACGTCCTCACCGACGTCTTCCCGGAGTCCACCGTCGCGGTCGACCGCGGCTG
GCACCTCGACTGGGAGCGGGAGCGCCTCGACGGGGCCCGCGCCGCAGGCCGCGACCACCTCTCCGTACGC
CTCCGGGGCGACGAGGTCCTCGTCGGACCGCTCTGGCGGGCCGGCACGGACGCGGGCTGCGCCGGCTGCG
CCGAGGTCCGCGACCGGACCGTGCCCGACCACCCGCTCGTCGGAGACCTCCGGCAGGCGACCGCCGCCCC
CGGGCCGGGCGCGCCGCTCCTCCCCGAACTGCTCCGGGCGACCCTGGAGCACCTGGTGAGGCGGCCGCTC
GGGCCCGGTGAACTCTTCTCCGTCTCGCCGCGCGGCCTGCGCCGCCACCGCGTCGCCCGCAGCTTCCACT
GCCCGCTGTGCGGACCGGCGTACGACCGCCTCGACGGCACGCGGACGCCGGCGCCGCTCGCCCTGACCGG
CCGGCCCGCCTTCCCGGACGACTGCACCCGCACCGCCGCGAGCCGGCTGGTCGAGCGCGGGGTCCTCCAG
GACCGGCTCGTCGACGACCGCTTCGGACCGGTCCGCGCCCTGCTGCGCGAGTCCCGTGCCCCGTTCGCGA
TGAGCATGGCCGTGGTGCCGGACGCCCCGGCCATGGGCCACGGCCGCGCCCGTACCTTCGCCGAGACCGG
TCCGGTGGCGGTCCTGGAGGCGTACGAACGGCTCGCGGGCTTCCCGTACGACATCCCGGTGCTCACCGAC
CGCTCGTACACGGAGGTCGCCGACCACGCCGTCGACCCGGCCGGTCTCGGGCAGTACACGGCCGAGCAGC
TCGCCCATCCGACCAGCCGGGCCACGCCGTTCGACGCGGACACCCCGATGGACTGGGTGTGGGGCCACGA
CCTCGGCGACGGCCGTCCGCTGCTCGTCCCCGCCGACCACGCCTTCTACCAGTACGAGTACAACCACCGC
CGGGACCGCAGGGCCGCCCGCGCCGCCGGGACGCCCGGCCGCAAGCACTACTTCTACGAGTCCTCCAGCG
GCTGCGCCGTCGGCGCCAACCTCGAAGAGGCCGCCCTGCACTCGCTGTTCGAGCTGGCCGAGCGGGACGC
GTTCCTGCTCTCCTGGCACCGGGCAGCCCCGCTGCCCACCATCCCGAACTCCTCCCTCACCGACCCCACC
AGCCGCGCCATGATCGAGTTGATGGAGTCGCGCGGCTTCGACGTGCACCTCCTCGTCGCCACCCAGGACA
TCGGCCTCCCGGTCGTCTGGGTGCTCGCGGTCAACCGGCTCAACCCCTTCCCCGCCACCTTCTCCTCGGC
CGGCTCCGGCGCCGACCCGCAGTCCGCGATCCGCGGCGCCCTGCGCGAGGTCGCCCAGCTCGTCACCAAC
CCGGTCGACTGGACCCGCGAGACCGTCGAACCGATGGTCGAGGACCCGTGGCTGGTCCAGGAGCTGGAGG
ACCACGTCCGGTTCTCCTCGCTGCCCGAGACCGCCGCCCGCGCCACCGCCGCCCTCGGCGGCCCCCGGGT
CACCCTCGACGAGGCCTTCCCCGGCTGGCCCGGGCGGATGGAACGCGGCTCCGGCGGAGACGTGCGCGGC
GCCCTGGACTTCGTCCGCGGACTCTTCGCCGAGGCCGGGCTCGACCGGATCGTCCTCGTCGACCAGACCA
GCCGCGAGCACGCCGACGCGGGCATCCACGTGGCCCGCGCGGTCGTCCCCGGCATCGTCCCGATGTGCTT
CGGCCACGCCCAGCAGCGGCTCGCCGGACTGCCCCGGCTCACCGCCGCGCTGCGCGGCACCGGGCAGGAG
CACCGGGCGATCCCCCTCGACCCCCACCCGTTCCCGTGA
 Primer design

Protein Sequence:642 a.a.
>SVEN_5136|ThioFinder678 Streptomyces venezuelae ATCC 10712
MPTDTLAISLALGPGLDAHPADEDWRSVLDVLTDVFPESTVAVDRGWHLDWERERLDGARAAGRDHLSVR
LRGDEVLVGPLWRAGTDAGCAGCAEVRDRTVPDHPLVGDLRQATAAPGPGAPLLPELLRATLEHLVRRPL
GPGELFSVSPRGLRRHRVARSFHCPLCGPAYDRLDGTRTPAPLALTGRPAFPDDCTRTAASRLVERGVLQ
DRLVDDRFGPVRALLRESRAPFAMSMAVVPDAPAMGHGRARTFAETGPVAVLEAYERLAGFPYDIPVLTD
RSYTEVADHAVDPAGLGQYTAEQLAHPTSRATPFDADTPMDWVWGHDLGDGRPLLVPADHAFYQYEYNHR
RDRRAARAAGTPGRKHYFYESSSGCAVGANLEEAALHSLFELAERDAFLLSWHRAAPLPTIPNSSLTDPT
SRAMIELMESRGFDVHLLVATQDIGLPVVWVLAVNRLNPFPATFSSAGSGADPQSAIRGALREVAQLVTN
PVDWTRETVEPMVEDPWLVQELEDHVRFSSLPETAARATAALGGPRVTLDEAFPGWPGRMERGSGGDVRG
ALDFVRGLFAEAGLDRIVLVDQTSREHADAGIHVARAVVPGIVPMCFGHAQQRLAGLPRLTAALRGTGQE
HRAIPLDPHPFP