Home 

Gene Symbol:  
SVEN_5135
Organism:  
Streptomyces venezuelae ATCC 10712
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5543802..5545583 [1], 1782 bp
Product Function:  
hypothetical protein
Product Locus:  
 CCA58421.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1782 bp
>SVEN_5135|ThioFinder677 Streptomyces venezuelae ATCC 10712
GTGACGATGCTCAAGGCACGCCCCGACCTGCACTACGCCCCCATCCCCGGCGGCGTCTACTTCAGCGGCG
CCCGCGCCCAGTTCGTCCTGCGCGGCTCCGAGGTCCTGCACGCCGTCGCCCAGGGCTGCGTCCCGCTCCT
GGAGGACGGCACCGACGAGGACGCGCTCGTCGCCGAGATCGGCACCGAACGCGCCCGCCCCGCCGTCCGC
CTCCTCGTCGACAAGCTCCGCGAGAACGGACTGCTCCTCGACCCGGCCGCGCACACCGCGCCCGAACCGC
CCGCCGCCGTACGGGAACGCCACACCGAGGCGCTCGCCCGCCTCGAAGGCCTCCTCGACGACCCGTACGG
CGCCTTCGCCCGGCTCCGGGCCGCGACCGTCCTCGTCACCGGACCCGCCACCGCGACCGGACCCGCCGTG
CGCGGCCTGCGCCGGGCGGGGATCGGCACGGTCCTCACCGGTACGGACGGGCCGGCCGGCGCCCCGGACG
CGGTCCTCGACATCCGCGAGGACGACGGGACCGGCTCCGTCGAGGCGCCCCTCGTCGTCCCGGTGCTGCT
CGGCGGCACCGGCGTCACCCTCGTCGGCCCCGCGGTCACCGGCCCCGGACCTGCGGTCACCGGCCCCGGA
CACCCCGCCGCGGGGGCCGCGTTCCGCGACCGGGCCCGTGCCTGGGCCGCCGCCGAGTCCACCGCGCCGG
CGCCCCGCCCCATGGCGGACGCGCTGGCCGGCGCCCTCGGCGCCCAGCTCCTCGTCGACGTCCTGACCGG
CACCGCCGACCCGGGCGAGGCCCACGTCGTGCACGGGACGGACCTGGTCTCCGACCGGGTGTCCGTCGAG
GGAGCCCACCCGGCGGCCGCGACCGGCCGACCGGGCTCCCTCCCCGAGACCCCGGAGCAGCCCTCCGACC
TCGGCACCGCGCCCGCCGAGCCCCGCCCCGAACCCGACGAGGCACGCGAGACGGCGACCCCGCTCGCCGC
CCGCTGGACCGGGCTCCTCGCCCTCACCGAGGGCGCCGACCTGCCCCAGATGCCACTCGCCCTGCGCGCC
GCCGAACTCCGGTCCGGCGGCCGCCCCCCGACCACGGTCCTCGCCTGGGCCGCCCACCAGGAGACCGCCA
CGGTGGCGGCCACCCTGGCGGCCCTCCGGGCCCTCATCCCCGGGGCTCCCACCCCGGCGGCCGGCCCGTC
CGCCCACATCCCCGGGGCTCCCACCCCGGCGGCCGGGCTCACCAGGGAACACTGGCTCCTCGACGGCGCC
CTGCGCCTGCTCGCCGAGGAGACCCGGCCCCTGCCGGCGACGACCGTCACCCCGCACGTGCCGCCCGCGG
CCCTCCCGGCGGGCGCCCCCGCCGTGGCCGCGGGCGGCGAGGAGGCGCTCGACCCCGAAGGCCTGCGGAT
ACTCGCCGCCCTTCGCCGCCTCCTCGGCCCCGAGCCCCACGTGCGGTTCCACTCCCTGCCCGGCCTCGGC
TGGCGGCTCGCCGAGGTGACCGCCGACGGCGCCCGCCTCGCCCGCGCCTGGGGCGCCGACGCGGCGGAAG
CCGCCCGGAACGCCCTGTGCACCGCGCTCGCCCGCACCCAGACGAGCACGGAGCCGGGCACCGTCGACCC
GCTCTCCACCGACGCCCTGCTCTTCGCCGACCGCGCCGCCCTCGACACCCTCCGGGCCGACCTCGCGGCA
CGCTCCGGCACCACGTACCGGGGCACGGCCGTCCGCCACGACCCGGTCCTCGGCGAGCTCCCCCTCTGGT
ACGGCCCCGTGGAGGCCCACGATGCCCACTGA
 Primer design

Protein Sequence:593 a.a.
>SVEN_5135|ThioFinder677 Streptomyces venezuelae ATCC 10712
MTMLKARPDLHYAPIPGGVYFSGARAQFVLRGSEVLHAVAQGCVPLLEDGTDEDALVAEIGTERARPAVR
LLVDKLRENGLLLDPAAHTAPEPPAAVRERHTEALARLEGLLDDPYGAFARLRAATVLVTGPATATGPAV
RGLRRAGIGTVLTGTDGPAGAPDAVLDIREDDGTGSVEAPLVVPVLLGGTGVTLVGPAVTGPGPAVTGPG
HPAAGAAFRDRARAWAAAESTAPAPRPMADALAGALGAQLLVDVLTGTADPGEAHVVHGTDLVSDRVSVE
GAHPAAATGRPGSLPETPEQPSDLGTAPAEPRPEPDEARETATPLAARWTGLLALTEGADLPQMPLALRA
AELRSGGRPPTTVLAWAAHQETATVAATLAALRALIPGAPTPAAGPSAHIPGAPTPAAGLTREHWLLDGA
LRLLAEETRPLPATTVTPHVPPAALPAGAPAVAAGGEEALDPEGLRILAALRRLLGPEPHVRFHSLPGLG
WRLAEVTADGARLARAWGADAAEAARNALCTALARTQTSTEPGTVDPLSTDALLFADRAALDTLRADLAA
RSGTTYRGTAVRHDPVLGELPLWYGPVEAHDAH