Home 

Gene Symbol:  
SVEN_5133
Organism:  
Streptomyces venezuelae ATCC 10712
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
5539886..5541079 [1], 1194 bp
Product Function:  
hypothetical protein
Product Locus:  
 CCA58419.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1194 bp
>SVEN_5133|ThioFinder675 Streptomyces venezuelae ATCC 10712
GTGAAGCCGGATTCCGACGGCCTGACGGGAGTGCGGCTGCACACACGGATGCCGGTCACACCGGCCTGGC
TCGCCCGGTACGTCGTACCGGTCGCCCGCGCGCTGAACGAGGCGGGCGCTCCCGCCGTCCAGCTGCGCCG
CGGGTGGCTCCACGGGCCGCACGTCGACATCCTCGCCCGCGACGCGAGCGGCGTCCCGGGCGGCGGCCCC
GACTGGGAGGCCGTCGCACGAGGCCTGGACGCCGGCCCGCTCGACCCGCCCCGGGCCCTCACCGAGGAGA
CCTACCTCGGCCAGGCGCGCGAGTTCGGGCGCCTGGAGGCCGTCCAGCCGCCCTACCTGCCGCTGCGCGA
ACACGGCGCCGTCGAACGGATCGAACCCGGCGAGCGGCCCGGCGCCACGCCCCGCGACCCGCGCCTCGAC
CGCTTCCGCACCGTCGTGCACGGGGCCCTGACACCCGCACTCCTGCGGACCGTCGACGACCTCGCCGGCG
AACCCGGCTCCGGCACCCTCCGGCTCGCCGAGGCCTTCGTCGCGCTCGCCGACACCCACACCCTCGGCCT
CGGATACGGGGTCTTCTCGCCCCGCTCCCACGTCGAGGCCTTCCTTGCCTGGGCCGCGCCCACCAAGGAC
GTCCGCCCCGTCTTCGCCGAGCGCCTCGCCAAGGACGCGCCGGTGCTCCGCAGGGTCGTCGAACAGCGGC
TGAGCGGCGAGGTCTCCGCGACCGCCGCCGCCTGGCGCACCGGACTCGCCTACGGGGCCGGCGCGCTGGA
GAGCGCGGTCGCCGCCGGGACCCTCACCCTCGACCTGCTCGACGGGGCCACCGCCGGGCTCGACCGCTCG
GAGATGGGCCCGCCCGGAGCCACCACGGTCGTCCCGCAGGGCGAGCAGCCCGACAGCGACTTCCACCGGA
CCGTCGGCGCGGCCGGGGTGACCTCGGCCCCGTCCCCGTGGTTCGCCTCCTTCCGCCTCCTGACCAACCT
CTTCTACGAGCAGCTGCCGCTGCTCACCGTCTCCCCGATGCAGCGCTACTACACCTGCTTCGCCGTCGCC
GAGACGGTCGACCAGGTCCTGGGCGTCTCCTGGCGCGAGCGGATCGCCGGCCGCCTGCCGAACGCCCCCG
CCGGGGAGACGAGTTCCGCCGCCCCCGCCCCGAGCGCCGCTCCGGGCACCGCCACCGAGGGAGCCCTGCG
ATGA
 Primer design

Protein Sequence:397 a.a.
>SVEN_5133|ThioFinder675 Streptomyces venezuelae ATCC 10712
MKPDSDGLTGVRLHTRMPVTPAWLARYVVPVARALNEAGAPAVQLRRGWLHGPHVDILARDASGVPGGGP
DWEAVARGLDAGPLDPPRALTEETYLGQAREFGRLEAVQPPYLPLREHGAVERIEPGERPGATPRDPRLD
RFRTVVHGALTPALLRTVDDLAGEPGSGTLRLAEAFVALADTHTLGLGYGVFSPRSHVEAFLAWAAPTKD
VRPVFAERLAKDAPVLRRVVEQRLSGEVSATAAAWRTGLAYGAGALESAVAAGTLTLDLLDGATAGLDRS
EMGPPGATTVVPQGEQPDSDFHRTVGAAGVTSAPSPWFASFRLLTNLFYEQLPLLTVSPMQRYYTCFAVA
ETVDQVLGVSWRERIAGRLPNAPAGETSSAAPAPSAAPGTATEGALR