Home 

Gene Symbol:  
SBI_02228
Organism:  
Streptomyces bingchenggensis BCW-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3039529..3040575 [-1], 1047 bp
Product Function:  
lantibiotic biosynthesis protein
Product Locus:  
 ADI05349.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1047 bp
>SBI_02228|ThioFinder700 Streptomyces bingchenggensis BCW-1
ATGAGCCGGCCGTCTGATCCGCCGACCCCGCCCGGGCAGTGGGTAGCCGTGCACCTCTTCCACCAGGGCG
ACCTCGACACGCTGCTGCTGGACGCCGTGGCCCCCGCCCTCACCGGCCTCGCCCAGGCCGGCCGTATCCA
CGGCCACTTCTTTCTGCGCTACTGGGAGGGCGGTCCTCATCTGCGCGTACGTGTCCTCTCCGGCGAACCC
GCACACCCCGTACACAACGGCTCCCAGGACATCGCCACCGAGCTTGTCGACCGGTGGAACGCATGGCTGA
AAGAACACCCCTCGCCGCGCTCCGTCGACGAGGCGGCGTATCTGCGCTTCGCCACCGAGGCCGCCGCCCG
CGAAGGGCTGCCCGGCTACGAGCCATGGCGCGGGCTGCACGACGAGGCGGAGGTGCGCGGCTATCTGCCC
GAACACGACCGCTACGGCACCGGCGCCCCACTCGCGGCGGTGGAACGGCACTTCATGGAGGCCAGCCGCT
GCGCCGAAGCCGTCCTCGCCCGCCGTCCCGGACCCGCCGAGCGGCTTTCGGCGGGCTTCGCGGTGTCCCT
GCTGACCTGGGCCGTGGTGGAACCCGATCCGCAGCGCCGCCTCGACGCGCTGCGCGCGGGCGCCGAGGCG
TGGCGCCGTATGCTCGGGCCCGCGTATGACACCGAGGCATTCGACCGCGCCTACGAGAGCGGCCGAGGAG
CCCTCGTACGCCGGGCCGGACACCTCCTCGCCCCCGCCCCGCGGCCCCGGTCCGACGGCCCCACAGGGCC
CATCGCGGCATGGCGCCACAGCGTCTCGCGGCTGCACGCCTCGCTCGAAGCCCTGGAGAGAAAGGGCGAG
TTCACGCCCGACCTGGGCGCGCTGCGCGACGATCCGTCGTTGCTCGACCTCCCCAGCCCGCGCGCCGCAC
TGACCGCCAACCGCTGCGCCCATCTGATGTGCAACCGTCTCGGGCTGTACGGACCGCAGGAAGCGCTGCT
GCGCCACTTCGCCGCCCGCGCGGCGGCCGATCTGCACACCGCCGGGAGCGGGGCCCACCGGCCATGA
 Primer design

Protein Sequence:348 a.a.
>SBI_02228|ThioFinder700 Streptomyces bingchenggensis BCW-1
MSRPSDPPTPPGQWVAVHLFHQGDLDTLLLDAVAPALTGLAQAGRIHGHFFLRYWEGGPHLRVRVLSGEP
AHPVHNGSQDIATELVDRWNAWLKEHPSPRSVDEAAYLRFATEAAAREGLPGYEPWRGLHDEAEVRGYLP
EHDRYGTGAPLAAVERHFMEASRCAEAVLARRPGPAERLSAGFAVSLLTWAVVEPDPQRRLDALRAGAEA
WRRMLGPAYDTEAFDRAYESGRGALVRRAGHLLAPAPRPRSDGPTGPIAAWRHSVSRLHASLEALERKGE
FTPDLGALRDDPSLLDLPSPRAALTANRCAHLMCNRLGLYGPQEALLRHFAARAAADLHTAGSGAHRP