Home 

Gene Symbol:  
SBI_02229
Organism:  
Streptomyces bingchenggensis BCW-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3040559..3043126 [-1], 2568 bp
Product Function:  
Lantibiotic dehydratase domain protein
Product Locus:  
 ADI05350.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2568 bp
>SBI_02229|ThioFinder701 Streptomyces bingchenggensis BCW-1
TCAGACGGCCGGCTCATGGAAGTCTCCCGGGAGTTCGATGACGAATTCGCTCGTGTACGGAGTGTCGCCG
TCGGGCGCGGCCGGGTCCGGCAGTGCCTCCTCGATGTGGACGACGGTGTCCGGGGAGCCGAGGGAGCGGG
TGAAGGCGGTGGTCAGGAGGGGTGAGGCGAAGTCGATGTACGCGGGTTTGTAGCCCTTGTCCGCGAAGGC
GTCCGCGCCGTGGCTCCCGGGTGCGCGGGTGCGAACGAAACAGGAGGCGGGAAGGCCCAGTTCACGGCGC
CAGGCCAGCAGCCTCAGAAAGTGTTCGTGGTCGCGCTCGCCGGGCGTACGGCGGGGCACCGACCCGGCCC
GGGTGAGCCATGAGCGGCGGCGCAGCACCACACGCCCGGCCTCGATCCGGTCCAGGCTCACCACGCCTCG
GTCCGGCACATCGTCGGCGAACGGCCCCGGCAGCAGCGGGTGTCCGGTGCGGAAGAGCGTATGCGGATCG
CCGAAGAGGCGCAGCAGGGTCGCCAGCGGCGGTGGCAGCAGCAGCGGGCTCATCAGGCCGAGGTGGACGG
GCACCAGATCGGCGTCGCAGCGTGGTGAGCGGAGTGCGGGCAGCCCGGTGGCCCGGTCGAGGCGCACGGT
CACCTCGCCGAGCGGAATGCGCCCGGGGCCGCTCCGGGCGCCGCGGGTGAACGGGTGGTCGAAGGCGTGG
GGCAGGGTGGGGTGCCGGAGGTTGGTGTTCGAGGCGTACAGACCGCCGATGTCCACGGGGATGCGGCCCC
GGCCCGTACGGGTGTCGGGGGCCGGGGACGGGGGCACGGGGCCGTCGGTGGCGCGGGCCCGCATCCGGTC
CAGGCGGCCCTGCCAGTGGCTGTGGCCGACGGTGACGGCGTTGAGCACGGCGCGCGGCCGTCCGTCCGGG
CCGGGCAGCGGCTGGATGTAGTGGGCGAGGCTGAGTGGCGGGCGGGGCGCGGCGACGTCGGTGGCCAGTT
CACCGGCTCGTAGGGCCTGGAGGACGGTGGCGCGGTGGTCGGTCAGGCGCCGCAGTACGGGCAGCGGGCT
GTCCCGCAGAAACGTGTCGTCGACACCGAAGCCGGGCCGCAGCAGGGCCCGGACGTGCTCGGCGGTGGGC
GATGGGTCCTCCCGTAGTTCGTGCAGGACGAGCAGCAGCGGCACATGGGGGTGCGGGCCGTGCCGTTCGG
CGAGCCATGCGGCCACGGCGTACCGGGCGGGCAGATCGCGGTCGAGGACGGCCAGCGCGCGCCCGACCGA
CGCGAGGTCGGCGAGCAGTGGCCGCCAGGGTCCGTGGCCGAGGGTGACGGCCGTGCCGTCGAGCACGGAG
TCCTCGTGGACGGGGCGGCGTTCGTACGGTTCGCCGGGGGCCGGGAGGCCCAAGGCGCCTTCCACGGCGA
GCAGCCGGTCGCGGGCCGCGCGGGCTTGGTCGCGGCGCTCGGCGTGGTCGGCAGGGCGGGGGCGGCGTGG
CAGCGCGGAGCGCAGGGCGGCCAGTGCATCGAGCGTGCCCTGGAGCGCGGAGGGGCCGTTATCGGTGGGG
CCGTTGTCGGTGAGGCCGTTGCCGGTGAGCCAGGTGATGAGCGCGTCGAGGTGGCAGGGCTCCAGATCGT
CAAGGGGAAGGTCTTCCTGGAGAATTCCGGCGGCCACGAAGCGCCGGACTCCCGGCCCCGCCTCGGCCAC
CGTGGCTCCGTCGAGGTTGCTCAAGGTGTCCAGGAGCCGTGGTGTCCGGTCCACGGCCGGGAAGGCGGTG
ACACGGGCCCCGGGGCCGGGGGCGATCAGGCGGAGGGTGCCGTCGGCGACGTTCAGCGCCGGGTTGAGGC
GCAGCCGCAAGGTGTCCCGCAGGGCCGGATGGGCGCGCAGCAGACCGTCGGCGATGCGGCGCAGCCGGGC
GAGGTTGAGTTCGGCGGTCGTGGTGCGCCGCTCCAGGTCTCCGGTGTGCAGCCAGGGGCCGTGGGCGGTC
CAGCGGCCTTGGCCGGTGGCGGTGAACGTCCCCTGCGGGCTGGTCTTCACGGCGGCCCGGGAGAGATAAC
GGGCCAGGCTGACCAGGGCCTTGGTGCCGGGAGTCGGGTGTCCCGGGGCGGCGATCCAGCGCTCCAGGAC
GTCGTCGAGCTCGGGCGTGGCGTGCAGCAGCCCCTGCCGGAAGCGAGGGTGCGCGAGGTCTTCCCGCAGC
GCGGCGAGCGAGTCGTGTGTCTCTTCCTGGAGCACGGCCGCCAGGGACTCGGTGTGTTCCCCGCACTGGG
CACGTCGGTCGAGCCAGCCCCGGATCCGGCCGACGAGCGGGCCGGGCAGCGCGGCCCGTACGTCTGTGTT
CCATTCGGCGGCCCGTGGTGAGCGGCCCTGATGGACCGCCCGGCGCAGCCCGATGACCCGGGGCCTGAGG
GCGGGTTCGGGCAGTGCCCCGATGACCAGGTGCAGGGCGTCGGCGATACGGCGGCCCTCCTCGGCGACCT
GTTCCCGCGTCTGAAGGATGTGCTCGGCGAGCTCGAAGCTCTTCGGCGTGTTCAGGACGGCGAGCGTGGA
GCGGGGGACCCCGGCGACACGCACCACCGGGTCGGGCGGGGTGTTCAT
 Primer design

Protein Sequence:855 a.a.
>SBI_02229|ThioFinder701 Streptomyces bingchenggensis BCW-1
MNTPPDPVVRVAGVPRSTLAVLNTPKSFELAEHILQTREQVAEEGRRIADALHLVIGALPEPALRPRVIG
LRRAVHQGRSPRAAEWNTDVRAALPGPLVGRIRGWLDRRAQCGEHTESLAAVLQEETHDSLAALREDLAH
PRFRQGLLHATPELDDVLERWIAAPGHPTPGTKALVSLARYLSRAAVKTSPQGTFTATGQGRWTAHGPWL
HTGDLERRTTTAELNLARLRRIADGLLRAHPALRDTLRLRLNPALNVADGTLRLIAPGPGARVTAFPAVD
RTPRLLDTLSNLDGATVAEAGPGVRRFVAAGILQEDLPLDDLEPCHLDALITWLTGNGLTDNGPTDNGPS
ALQGTLDALAALRSALPRRPRPADHAERRDQARAARDRLLAVEGALGLPAPGEPYERRPVHEDSVLDGTA
VTLGHGPWRPLLADLASVGRALAVLDRDLPARYAVAAWLAERHGPHPHVPLLLVLHELREDPSPTAEHVR
ALLRPGFGVDDTFLRDSPLPVLRRLTDHRATVLQALRAGELATDVAAPRPPLSLAHYIQPLPGPDGRPRA
VLNAVTVGHSHWQGRLDRMRARATDGPVPPSPAPDTRTGRGRIPVDIGGLYASNTNLRHPTLPHAFDHPF
TRGARSGPGRIPLGEVTVRLDRATGLPALRSPRCDADLVPVHLGLMSPLLLPPPLATLLRLFGDPHTLFR
TGHPLLPGPFADDVPDRGVVSLDRIEAGRVVLRRRSWLTRAGSVPRRTPGERDHEHFLRLLAWRRELGLP
ASCFVRTRAPGSHGADAFADKGYKPAYIDFASPLLTTAFTRSLGSPDTVVHIEEALPDPAAPDGDTPYTS
EFVIELPGDFHEPAV