Home 

Gene Symbol:  
SBI_02227
Organism:  
Streptomyces bingchenggensis BCW-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3038051..3039532 [-1], 1482 bp
Product Function:  
hypothetical protein
Product Locus:  
 ADI05348.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1482 bp
>SBI_02227|ThioFinder699 Streptomyces bingchenggensis BCW-1
ATGAGCCCGCTGCTTCTCTCCCTCTACCCCGGCACCGCCCTCCACGACCACCAGGGCCTGCTGACCGTAC
GCCACCGCTGGGGCCGTACGCCGCTCGGCCCGCACACCCCGCCCCTGGCGGAAGCGCTGCACACCCTCGC
GGCGGGCCCCACGGCCATCGACGAGATGGCGGACCGCATCAATGCCAGGGCGGAGAGCTGCGGGCTGCCG
CCGGAGCCCCAACTCGCCCTGTTCCACCATTGCCTGGACCGGCTCGGGCACACCCTCCAACGGCACGCCA
CCCACGGCTCCCGGCCCCTGGCGACCGCCGTACCGCTCGCCCCCGAAGCCGCACCGCGCCCCGGACCCGT
GCCCGACACCCCGCTCACCCTGGACCGCGCCGCCCATCTGCGGCCGGTCGACGGCCAACTCGCCCTTGAA
TCGCCACGGTCACGTTTCCGGGTCCGCGTCGAGGACCCCCGCACCGCCACGCCGCTCGCGCTCCTCGCCC
GCCCCGCATCCCGCGCGGAGCTGGGCCGCCACTGCCACGAACTGCCCGAGGGCGCCCTGACCGCGCTCCT
GACCCTTCTGCACTCGACCGGTTTCCTGCACCCTGTCGGTGACGCCGGGCGTGACGCCGGGCGCGCCGAC
ACCGCCGACCTCCCGTCCGGCTGGAGCTTCCACGAACTGCTCGCCTACGACGGCGCCCGAGCCGGCCCGC
GCGACCGCCTGTACGGGCCGGTCTTCCCGCTGCGCGACACCGAACCACCACCTCCGCCCGTGCCCCGACC
CGCCACGGGACGTACGATCCCCCTCCGCCGCCCGGACCTGGACAGGGCGGCCCGCGAGGACCGCACCTTC
ACCGACGTACTCGAATCGCGGGCCTCACGGCGTACGTACGGCGAACGGCCTCTGACCCGGGACCAGTTGG
GGGAGCTGCTGTACCGGGCCGCCCGGGTGCGCACCGTGCTGGCCGCCCGCCCCGAGGACGACCGACCGTA
CGCGGTCACCAGCCGCCCCTACCCCAGCGCCGGATCTGCCTACGAACTGGAGCTGTACGCCGCCGTCCAC
CGCTGCCAGGGGCTGGACCGGGGCCTGTACCACTACAACCCCCTGGGCCACGCCCTGACCGCCCTGCCCG
GCGCCCCCGGAGCCGTCGACGGCCTGTTGCGCGAGGCCTCCGCCGCCACCGGCGCCGCGCCCCCGCCCGA
TGTGCACCTCACGCTGGTGTCCCGTATCAAGCGGCTGTCCTGGAAGTACGCGGCACACTCCTACGCCCTG
ACCCTCAAGAACACCGGCGTCCTGCTCCAGACCCTCTCCCTCGTCGCCACCGCGATGGGCCTGTCGGGCT
GCGCGGTGGGCGGCGGGGACAGCGAGACCCCGGTACGCGCCTTCGGCCTCGCCGCGCACACCGAGATCCC
GGTGGGCGCCTTTCTGCTCGGCAGCGCGGCGGCCGACGGCCCAAACTACGCGACCCCGCCCGCGAGCACG
CGGCGCCGGTAG
 Primer design

Protein Sequence:493 a.a.
>SBI_02227|ThioFinder699 Streptomyces bingchenggensis BCW-1
MSPLLLSLYPGTALHDHQGLLTVRHRWGRTPLGPHTPPLAEALHTLAAGPTAIDEMADRINARAESCGLP
PEPQLALFHHCLDRLGHTLQRHATHGSRPLATAVPLAPEAAPRPGPVPDTPLTLDRAAHLRPVDGQLALE
SPRSRFRVRVEDPRTATPLALLARPASRAELGRHCHELPEGALTALLTLLHSTGFLHPVGDAGRDAGRAD
TADLPSGWSFHELLAYDGARAGPRDRLYGPVFPLRDTEPPPPPVPRPATGRTIPLRRPDLDRAAREDRTF
TDVLESRASRRTYGERPLTRDQLGELLYRAARVRTVLAARPEDDRPYAVTSRPYPSAGSAYELELYAAVH
RCQGLDRGLYHYNPLGHALTALPGAPGAVDGLLREASAATGAAPPPDVHLTLVSRIKRLSWKYAAHSYAL
TLKNTGVLLQTLSLVATAMGLSGCAVGGGDSETPVRAFGLAAHTEIPVGAFLLGSAAADGPNYATPPAST
RRR