Home 

Gene Symbol:  
SBI_02231
Organism:  
Streptomyces bingchenggensis BCW-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3044136..3046001 [-1], 1866 bp
Product Function:  
putative cytoplasmic protein
Product Locus:  
 ADI05352.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1866 bp
>SBI_02231|ThioFinder703 Streptomyces bingchenggensis BCW-1
GTGGTCGGGGACGGCGGCCTGCTCAACCAGGCCATCGCCGAGCGCCTGACCTCAGAGCGCCTGGCCTCAG
GGCGGGATTTACGCACCCACGCCGTCCTGCTGACCGTGAGCGACGGATGGGAGAGCGACGCGGCACACGA
CCGCCACCGGCGCCGCGCCCTCGCCTCCGGTGTCCCCTGGCTTCCCGTGTGGACCGAGGGCGCCCGCGCC
CTGATCGGCCCGCTGGTCCGTCCGGACGCCCCCGGCTGCCACCGCTGTCTGCGTATGCGGCGCGCCCACG
CCCGCGAGGACTGGCCGGTGGTACGGGCGGTGCGCGAGCGGTACGCCACCGAGCCGGAGCCCGAGCGGTC
CCCGCTGCTCACCACGGTGGCAGCCGAGATCACGGCCCATCTCGTCGCCGCGCGCCTCATGGCCGCAGCC
ATCCCCTCCCGGGAACTGACCGTCATCGGCCTGCGGACCCTCGACGTCAGCAGCCACACCTTCCTCCCCG
ACCCCTGCTGCCCCGAATGCGGCGGGCTGCCGGACGACAGCCCTCAGGCCGCGCCCCGGACACTCCGCCC
CCGCCCCAAACCCCGCCCGGGCCACCGGCTGCGCCGCCCCGACGCCACTCGGCTGCGCGCCGCGCTCGCC
GACCCCGAGACCGGGCTGCTGCGCGAGGTGAGCGCGGTGTCCGCCGGGGTGCCCCTCGCGCGGGCTCCGC
TCACGCTGCCCGGTGGCGGCGAGTTCGAGGCGGGCCTGGGGACGGGCGACGAGTGGGGCGCCGCGCAGGC
GGCGGCGCTGCTGGAAGGCGTCGAGCGGTATGCGAGCGTACGGCCGCGGGCGCGGCGGGCCGCGGTACGG
GCCGCGTACGCCGAGGTGCGCGAGGACGCCGTCGACCCGCGCACACTAGGGCTCCACCCGGACGGCCACT
ACGACCTGCCCGGTTTCCCCTTCCGCCGGTTCGACGAGGCGGCGGTGACCGAGTGGGTGTGGGGCTGGTC
GTACGGCCGGGACCGGCCCCTACTGCTGCCGCAGTCCTACGTCTACTTTCTGTCCGCCACCGAGCGGGAC
CGCGCCTTCGCCTTCGAGGTGTCCAACGGCTGCGCGCTGGGCAGTTGCCTTGAGGAGGCCCAGCTGCACG
GGCTGCTCGAAGTGGCCGAACGGGACGCCTTCTTCACCACCTGGTACCGGCGCACCCCGCTCGACGCCAT
CGACCCGGACAGCGCCCGCGACCGCACCGTACCGCTCCTGGCCGAACACCTCACCCAGCTCACCGGACAC
CGCGTCCATCTCCTCGACGCCACCCAGGAACAGCACATCCCCTGCGTCGTGGCCCTCGCCGTGGACGAGG
ACGAGCGGCCGGACACGCCCCGCGCGGCCGTCGCGGCCGGCGCCCACCCCGACCCGGAACAGGCCGCTGT
ACGCGCCCTGATGGAGCTCGTGCCCCATCTGACCCTGCTGACCTCCCGCTACCGGGCCGAGCGGGAACGG
GCCCGCCAGCTCGCGCTCGACCCCTCGCTCATCGCGCACCCCGCCGACCACGCCCTGGCCGCCGCTGCGC
CCGAGGCGTTCGTACGCCTCGCCTTCCTGCGTGGCGGCAAGCCGCCCCGCACGTTCACCGAGGTGCACCG
CGGCCGGCACCTGCCGCGATACCACGGGGACCTCACGGACGATCTGCGCGATCTGATCCGCCGATACCTG
GAGACCGGACTCGATGTGATCGCCGTCGACCAGACGCCCGCCGAAGTGTCCGCGCTGGACCTGGCGGCGG
CCAAGGTCGTCGTCCCCGGCACCGCCGCGGTCACCTACGGACCGCTCATGCGGCGCACCGAAGGGCTGCC
CCGGCTCACCGGTCACCTGTCCGCCGACCCCCACCCCTTCCCATGA
 Primer design

Protein Sequence:621 a.a.
>SBI_02231|ThioFinder703 Streptomyces bingchenggensis BCW-1
MVGDGGLLNQAIAERLTSERLASGRDLRTHAVLLTVSDGWESDAAHDRHRRRALASGVPWLPVWTEGARA
LIGPLVRPDAPGCHRCLRMRRAHAREDWPVVRAVRERYATEPEPERSPLLTTVAAEITAHLVAARLMAAA
IPSRELTVIGLRTLDVSSHTFLPDPCCPECGGLPDDSPQAAPRTLRPRPKPRPGHRLRRPDATRLRAALA
DPETGLLREVSAVSAGVPLARAPLTLPGGGEFEAGLGTGDEWGAAQAAALLEGVERYASVRPRARRAAVR
AAYAEVREDAVDPRTLGLHPDGHYDLPGFPFRRFDEAAVTEWVWGWSYGRDRPLLLPQSYVYFLSATERD
RAFAFEVSNGCALGSCLEEAQLHGLLEVAERDAFFTTWYRRTPLDAIDPDSARDRTVPLLAEHLTQLTGH
RVHLLDATQEQHIPCVVALAVDEDERPDTPRAAVAAGAHPDPEQAAVRALMELVPHLTLLTSRYRAERER
ARQLALDPSLIAHPADHALAAAAPEAFVRLAFLRGGKPPRTFTEVHRGRHLPRYHGDLTDDLRDLIRRYL
ETGLDVIAVDQTPAEVSALDLAAAKVVVPGTAAVTYGPLMRRTEGLPRLTGHLSADPHPFP