Home 

Gene Symbol:  
SBI_02232
Organism:  
Streptomyces bingchenggensis BCW-1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3046015..3047925 [-1], 1911 bp
Product Function:  
group-specific protein
Product Locus:  
 ADI05353.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1911 bp
>SBI_02232|ThioFinder704 Streptomyces bingchenggensis BCW-1
ATGGGCGGCCGTCGGCTGAAGCTGGTGCGGCAGGTGAGGTACGCGCCGACCGAGAACGGCGCCGCCGTGC
TCGGACCGTCCGGCGCGCTCGCGCTTCGCGGAGCCGGTGTGTACGCGTGGCTGGAGCGGCTGTGGCCGCT
CCTCGACGGCGCCCAGGACGTGGACGCCGTACTCGCCCAACTCCCCGACGGACACCGGGCCGTCGCCACA
CGTCTGCTGGAAACCCTCCAGCGGCGGGACTTCCTACGGGAGGCCACCGAGCCACGGCCGCACGGCCTCA
CCGTCACCGAACTGCACCGCCACCGCCACGAGATCGCCTACATCGGACACTGGCTCGACTCCCCGGAACA
CCGCTTCGAGCGCTATCGCACCGCCCGTGTGCTGCTGCTCGGCGACGGTCCGCTGTACGCGGCCACCCGG
CACGCCCTCCTCGCCTGCGGACTGCGTCAGGTACAGGTGCTCACGGAGGACGCGAGCGCTCCGTACGACA
CCCTGCGCGCGGCGGCTCGCACCGCCGATGCCGTGGTGTTCACGCGCGACGCGACCACCCCTCAAGCGGG
GCCGGGCGTCGCGGCCGTTGAACGCGCCTGCGGCGGGGTGCCGCTGTTCCGCGCGCTGAGCCGGCCCGCC
GACTGCTGGCTCCTTCCGCCCACCGCGCCCCTCACCTGGGCCGATGTACGACACCGGATACGGCACACCG
CCGCCCCGGACAGCGCCGGACCCATTCCCATGACGGCGGCAGCCGCCGCGCTCGTCGGCGGACGGCTCGC
CCTGGCCGTCTTCCGCCTCCTCACCGGGGTCCCCGACGAGGACACCGATGTGGACGCCGACGCCCCTGGT
CCCGTACCCGGGATCCTCCGCGTCGACCTCACCACGCTCGCCGCGCACCGCCACCGGGTGCTCCCCGCCC
CACGGCGCCACGACTCGGCGTGCGCCGAAGGCCGGATGAAAGAGTTGCGCGAGGCCCCCGCGCTCGACCC
CGACGAACTCACCGCACGGCTCGCCGACTGCGCCGACGACATCGCGGGACCATACGCACCGCCCACCATG
GAGTACGGCAGTCAGATACCGCTCACCGTCGCGCAATGCGTCGTGGCGGGCGCGGGGGTGGTGGTCGGTG
CCTCCCTGGACCCACGGGCCGCCAAGGCCGTGGCGCTGCGCCGCGCCGGGGCGTCGTACGCGCTGTCCGC
CGCCGGATACGTACCACCGCAGCCATCCGATCAAGCCGCTCCGGACCCCGCCCGCTTCCGCGCCGAACGA
CTGACGGACGGCGGTGTGCGGTCTCTGCCCGCGTCGCTTGTGCTGCCGTGTCCGGCGGGGGAGGGGCAGC
AGGGTGGCCGCCCCGTGGGCGCGGGCACCGCGTGCGCCGAGAGTTGGGATGCCGCGGTGGAGGCCGCCCT
CTTCGCCGCCGTACGCTCGCTCGCGCGGCAGCGCGCGGCCGACCTGCCGTCTGCCACGCTGATGCCGGAA
GGGCTGCTGACCGAGCCCGAAGCGGTGCGCCATTGGCGGCTGTTGTGCACGCTCGGCCCGGTACCCGAGG
CACGGGATCTCTCCGGCGGGCTGGTGGCGCCGGTCATCGGCCTGGTGGCCGGGGACCGGCTCGCCTCGGT
GGGCTGCGCCGCCACCGCGGCCGGAGCGCTTGCCGAGGCCGCGCGTGAGCTGTTGCTCGCCCGGCAACGC
GGAACCGAGCCGGCTGCGGGAGCCCTGCCGCTCCCCACCGCATCGGGGCCGCCCACCAGCCACGTACCCG
CCTCGCTGCCCGGCTCCCTCCCCCAGGAGCGCATCGCCCACCTCGGCACGAGCCTGGCGGCTGAGGGATA
CACCGCGTACGCCGTGCCGCTCGACCACGACGCGGACTTCCACGCGCTCGTCCCCTTCATCGCCCGGGTG
GTTCTCGATGAGGCCCACTGA
 Primer design

Protein Sequence:636 a.a.
>SBI_02232|ThioFinder704 Streptomyces bingchenggensis BCW-1
MGGRRLKLVRQVRYAPTENGAAVLGPSGALALRGAGVYAWLERLWPLLDGAQDVDAVLAQLPDGHRAVAT
RLLETLQRRDFLREATEPRPHGLTVTELHRHRHEIAYIGHWLDSPEHRFERYRTARVLLLGDGPLYAATR
HALLACGLRQVQVLTEDASAPYDTLRAAARTADAVVFTRDATTPQAGPGVAAVERACGGVPLFRALSRPA
DCWLLPPTAPLTWADVRHRIRHTAAPDSAGPIPMTAAAAALVGGRLALAVFRLLTGVPDEDTDVDADAPG
PVPGILRVDLTTLAAHRHRVLPAPRRHDSACAEGRMKELREAPALDPDELTARLADCADDIAGPYAPPTM
EYGSQIPLTVAQCVVAGAGVVVGASLDPRAAKAVALRRAGASYALSAAGYVPPQPSDQAAPDPARFRAER
LTDGGVRSLPASLVLPCPAGEGQQGGRPVGAGTACAESWDAAVEAALFAAVRSLARQRAADLPSATLMPE
GLLTEPEAVRHWRLLCTLGPVPEARDLSGGLVAPVIGLVAGDRLASVGCAATAAGALAEAARELLLARQR
GTEPAAGALPLPTASGPPTSHVPASLPGSLPQERIAHLGTSLAAEGYTAYAVPLDHDADFHALVPFIARV
VLDEAH