Home 

Gene Symbol:  
mur2
Organism:  
Streptomyces sp. NRRL 30471
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
6047..6994 [1], 948 bp
Product Function:  
dehydratase
Product Locus:  
 ADZ45315.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:948 bp
>mur2|ThioFinder1123 Streptomyces sp. NRRL 30471
ATGCGCCACGAAAGCCGCGTGGGCGGCGACCGTTCCTGGGTGAGCGCGCATCTCTTCTCTCAGGGCAACC
TTGATCGCGTGCTGACCGACCTGGTGGCCCCCTTGCTCGACGAACTGCGTGAGCGGCGGTGGGCGGACCG
CGGGTTCTTCCTCCGGTACTGGGACGGCGGCCCACATATCCGGTTGCGCGTGCTGCCCTCCTGCCAGGAG
GCTGCCGCCGGGGTACGCGGCCTCATCGAGCAGCGGGCCACCGCGTACTTCGCGCACAGCCCGGCCCCGG
AGGTGCTGAGTCAGGAGGAGTATCTGCACTCCGCCCGCGAGATCGGGGCGTGGGAAGGGGTGCGGCCCAC
GGAGCGCATGTACGCCAACAATTCCGTGCACTTCCTGCCCTACGTTCCCGAGCATCACCGCTACGGTCAG
GGCGCGACGCTGCACTTGGTGGAGGAGCACTTCAGCACTTCGAGCGAGCTCGCATTGGACCTGCTGCGCG
GTGCAAGCAGCCCCGAACAGCGTGAACTGGCCGCCCTGTGCCATCTGTTGCTGGCTTGGTTCCTCGGTGC
TGAGGACGTGCGCGAACTCGCAGGACGGCAGCTCGCCAAAGTGTCCGCTCGGCGCGCGCCCGGCACAGCG
GAGACGATCACGGCGTCGGACGCCCAGTTTCTGCGCCGGCGCGAGCGAGTGCTGACCCTCGCCGCCACCA
TGCGCAAGGTCGGGCGCGCATGGCCCCACATGCCGGACGACAGCGGTCTGAAGCGGTGGGCGTCTTCCGT
CTCGGGCGTGGTGGACGCGCTGGGCGCGGACGCGGGCGCGCCGTCAGCGGAGTCAGCGGCGGACCTGTGC
GCGCACCTCTTCGCCAATCGCGTCGGGGTACGCATCGACGCCGAGGGCTCACTGCGTTACCTGGCGGCTC
GTGCCGTCACGGATCCTGCCGTATACGAGGGGGCATGA
 Primer design

Protein Sequence:315 a.a.
>Mur2|ThioFinder1123 Streptomyces sp. NRRL 30471
MRHESRVGGDRSWVSAHLFSQGNLDRVLTDLVAPLLDELRERRWADRGFFLRYWDGGPHIRLRVLPSCQE
AAAGVRGLIEQRATAYFAHSPAPEVLSQEEYLHSAREIGAWEGVRPTERMYANNSVHFLPYVPEHHRYGQ
GATLHLVEEHFSTSSELALDLLRGASSPEQRELAALCHLLLAWFLGAEDVRELAGRQLAKVSARRAPGTA
ETITASDAQFLRRRERVLTLAATMRKVGRAWPHMPDDSGLKRWASSVSGVVDALGADAGAPSAESAADLC
AHLFANRVGVRIDAEGSLRYLAARAVTDPAVYEGA