Home 

Gene Symbol:  
mur1
Organism:  
Streptomyces sp. NRRL 30471
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3783..6047 [1], 2265 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 ADZ45314.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2265 bp
>mur1|ThioFinder1122 Streptomyces sp. NRRL 30471
GTGACCGCGGAGCGGGAAACGCACGAGGAAACGAGAAGCCTCCTCAAAGCAGCCACCGACCCAGTGTTCC
GGCATGCTCTGTCTCAGGCCAGTCCCGCCCTGCTGGACGAACTGTTGCGCCTTGAGCTCGCCGGCCAATC
GAAGCTGCGGCGGCGGACGGCCATCGGGTTGACGAAGTTCGTTTCCCGAGCGGCCACCAAGACCAGCCCG
TACAGCACCTTCACCGCAACGGCCGCCGGGGCCTGGTCCGGCACCGGGCCGCTCTTCTCCTCGTCGGTCA
GCGACGAGCTGCGCTGCGTGCTCGAACTGGACCGCATGGTCCTGGAGCAGGCCGTCAACTCATTGCTCGC
TGACGGCGAGCCGAGCGATGCCTTGCGGATCCGGCCGAATCCCAGCCTGAACGAGCTCGACGGCCGATAC
ACCTTCCTCGGGCGCAGGCCGGCAGAGCCATTGGTGGCGATACGCGCCTCCCGGGAAGTCAGGGAGTGCC
TGAGGATCGTCGGTCGCGGATGCACGGTGGAGCACCTGCACAGCACATTGGCTGCGCGTACCCCACAGCA
GTCGGCGGCGGTCGTACGGTTTTGCGCGCAACTCGTCCGGATGGGCGTGCTGGAGTACGAATCGCCGGTG
CCGGACCAGTCGGAGAGGCCACTGGACGACCTCATCAGGTTCCTTGGTGCCACGGCTACGGACCGGGGGC
GGAAGGTCATTCCCTTGCTGGAGTCCCTCCGCGAGAGACTTCAACAGGATCCATCGCCGACAGCCGTCGC
CCCGTACCGGGAGCAACAGCGCGCGATCTCCACGCTGGTCGCCCACCTCGGGCAGGAACTGGGGCTCGAC
TGGCCCGAGGCCGACGTTCTGCGCAAAGTCGCCTTTCACGAGAATGCCGTCCGCGTCGGGGGTGACATCA
GCTGCTCGGCTCCTCATTGGCGGCCGCTGCTCGACGACTTGGACGCGCTGCGCCGCTGGCTTGCCCTGCA
CGATCGCATGCTGCCCGTCCGCATCGCGCTCACCGCGTATGCCGGACACCGCTTCGGTACCGGTCCGAGC
ATTCCGTTTCTTGCGTTGCATGCGGCGGTGCAGGCCGACCTCGCGCGCAAGGATGCTGACTGCCCGAAGT
GGCTGCGCCCGTTGCGCCCCTTCCTCCAACTCAGTAATCCGGTCCCCGCTGACGAGCTGGCGCGGAGCCC
CCTGCCCCCGCTGAGTCGGCTGCACCGACTGCGCCGCGAGTCCCTGGAAACCGTGCTGTCGGCCGATCAG
CAGGAAGGCAGCGTCCTACGCACGGATCCCGCGGTCCTGACGGAACTGTCATCCCAGTGGCCCGACTGGG
TCCGCACCCCCGGATCGATCGCCTGCTACCTCCAGCCGTACACCGTGAACGGCGAACTGAAGGCAGTGGT
GAACACGATCAGTGGCGGATGGGGGAAGGGGCGTGCTCGATGGTCGCGTCTGCTCGACCAGGCCGGCGGG
CGCATCCACGAGGCGCCACGGACCGATGACGATGCGCACGCTCCGCTCCTTGCCGAGATGTCCGGCACCT
TCGGGGTATCGGTGAACCTGCGGAGGGCCGTCGCCCCGTATGAACTCGACTACCCGTACACCACCAGTAC
GCGCCCGGACGACGAGCGGATCCCCCTCAGCGATCTCCTCGTGCGACACGCGGCGTCGGGGGCGACGCTC
GAACTGTGGTCGCGGTCCAAGGGCCGGCGTGTTCAACCCGCGCATCTGGGCATGATGGCCGATCCGTTGC
TGCCGCCTGCGGCCCGCTTGCTGTTCGCGGCGTTCGGGCAGTCTTACCTGCTGCACCCGAGCCTTTCGCT
GCTCAAGCGCCGAGAGGTCGCCGAGCCCTCGGACGTCGTGTTCCAGCCGCGTATCGAAGTGGGCAGGGCC
GTTGTGCAACGGGCCGAATGGTCGGCCCCGATCGCGTGCGTACCGCAGGAGCGCACCGGCGAACCGGACG
GTGCATATCTGCTGCGCTTGGCGCAGTGGCTGCGTGCTCACCAGATACCCCGGCGCTGCTTCGTCCGCTT
GTATGCGACCGATGGTGACTGGGTGAGCCGGGTGTTCGTGAAGTCAAGGAAGCCCATGTTCCTCGACTTC
GCCAGCCTGTCGATGGTGGCCGTCTTCAGGAACATGACCAAGGAGTTCAGCGGCAGAGTCGGCTTCGAGG
AAGCCTTGCCCGACCCTTCCGATCCGTCTCCGTTCGAGTGTGGTGGGCCCAGAGTCGCCGAGTTCGTCGT
CGAACTGACCGCGGCCGGCTCCTGA
 Primer design

Protein Sequence:754 a.a.
>Mur1|ThioFinder1122 Streptomyces sp. NRRL 30471
MTAERETHEETRSLLKAATDPVFRHALSQASPALLDELLRLELAGQSKLRRRTAIGLTKFVSRAATKTSP
YSTFTATAAGAWSGTGPLFSSSVSDELRCVLELDRMVLEQAVNSLLADGEPSDALRIRPNPSLNELDGRY
TFLGRRPAEPLVAIRASREVRECLRIVGRGCTVEHLHSTLAARTPQQSAAVVRFCAQLVRMGVLEYESPV
PDQSERPLDDLIRFLGATATDRGRKVIPLLESLRERLQQDPSPTAVAPYREQQRAISTLVAHLGQELGLD
WPEADVLRKVAFHENAVRVGGDISCSAPHWRPLLDDLDALRRWLALHDRMLPVRIALTAYAGHRFGTGPS
IPFLALHAAVQADLARKDADCPKWLRPLRPFLQLSNPVPADELARSPLPPLSRLHRLRRESLETVLSADQ
QEGSVLRTDPAVLTELSSQWPDWVRTPGSIACYLQPYTVNGELKAVVNTISGGWGKGRARWSRLLDQAGG
RIHEAPRTDDDAHAPLLAEMSGTFGVSVNLRRAVAPYELDYPYTTSTRPDDERIPLSDLLVRHAASGATL
ELWSRSKGRRVQPAHLGMMADPLLPPAARLLFAAFGQSYLLHPSLSLLKRREVAEPSDVVFQPRIEVGRA
VVQRAEWSAPIACVPQERTGEPDGAYLLRLAQWLRAHQIPRRCFVRLYATDGDWVSRVFVKSRKPMFLDF
ASLSMVAVFRNMTKEFSGRVGFEEALPDPSDPSPFECGGPRVAEFVVELTAAGS