Home 

Gene Symbol:  
mur4
Organism:  
Streptomyces sp. NRRL 30471
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
8106..9491 [1], 1386 bp
Product Function:  
dehydrogenase
Product Locus:  
 ADZ45317.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1386 bp
>mur4|ThioFinder1125 Streptomyces sp. NRRL 30471
GTGAGCCATGGGGACGTGCGCCGCCTGTACCGGCTCAAAGAGGGCGTGCACAGTGTGCGGACCGCCTCTG
GCGAAGTGGTTCTGGCCGCCTGGCCGCACCTTCAGGAGATGGGGCGACTGACCGCCGAGCAGCGGTCGCT
GCTCCAGGTCCTGGCCACGGACCGGTCGGCCGAGAAACTCACCGAACGCTGTCCCCGCGATCAGGCCGAC
AGGTTGCTCGCCATGCTGTCCTCGGGCGGCTGGCTGATCACCACCGTCGTCTGCGGAGACCGTCCCCTGT
TCAGCAGTCAGCCGCTGGTACCGCACCGAAAGCCCTTGCCTCCCGCAGAGCCGCGCCGGCTGTCCCGGTT
CGCCTCGGTCCGCAGGGACGGTGACGCGATCGTGGTGGAGTCTCCGGCTGCCGGGGCGGAGGTGCGCCTG
TACGACAGCCGTCTCGTCGAGCCGGTCCTGACGCTGGGTGCGGCACAGCAGGAACGACCTGACGTGCCCC
TGGAGGCGGTACGCCTGCTCACCGACGAGCTTGCCCACCGCGGCTTCCTCGCGACCACGGCCGAGACGAA
CTCCCTCAGCAGCGTCCAGTGGAGCCCCCATGAACTGGCCTTTCACCACGGCAGCAGACTGCGCGGCGAC
CACCGGATGGGGCGGGACTTCGGCGGATCGTACTGGGCGAAGGGGAGGTTCGACGCGCCACCGGGCAAGC
ACCCACGGTGGCCCGCGGCGGCCATCGAGCTGCCGCGGCCCGACCTGGACAGACTCCGCGTACAGGATCC
CGCGCTGACTGAGGTCATGGAAGAACGGTGCTCCATCCGCTCCTACGACGAGGACAACCCGCTGACCGTC
GAGGAGCTGGGTGAGTTCCTCTTCCGCACGGCTCGGGTGCGGGCAACGGGGACGGACGCCGAGGGACTCG
ACGTCTCCAGTCGGCCGTACCCCGGGGGCGGTGCTGCCTATGAGCTGGAGATTTACCCGCTGGTCCGCAA
CGTGCGTGGGCTGGACGCCGGCCTCTACCACTACGCCCCGCACGGCCACCGGTTGCTTCCAGTCCCGGCG
TCGGCAACAGCCCTGCGCTGGCTGATGAAGGCGTCGGCAGCGGGCATGACCGGCGAAGCCACACCCCAGG
TGCTGCTGGTCATCGCCACCAGGTTCGGTCGCCTGGCGTGGAAGTACCAGGCGATGGGGTACGCGTTGAC
GCTCAAGCATGTCGGGGTGCTGTACCAGAGCATGTACCTCGCGGCGACAGCCATGCGGCTGGCGCCCTGT
GCGCTGGGGGTGGGCGACTCGGATGCCTTCGCCGCGGCAACCGGGCTGGACTACTTCGAAGAGACCAGTG
TCGGCGAATTCGCACTGGGCAGTCTCCCCGCGGCGCGGAGAGAGAGCACCGGATGA
 Primer design

Protein Sequence:461 a.a.
>Mur4|ThioFinder1125 Streptomyces sp. NRRL 30471
MSHGDVRRLYRLKEGVHSVRTASGEVVLAAWPHLQEMGRLTAEQRSLLQVLATDRSAEKLTERCPRDQAD
RLLAMLSSGGWLITTVVCGDRPLFSSQPLVPHRKPLPPAEPRRLSRFASVRRDGDAIVVESPAAGAEVRL
YDSRLVEPVLTLGAAQQERPDVPLEAVRLLTDELAHRGFLATTAETNSLSSVQWSPHELAFHHGSRLRGD
HRMGRDFGGSYWAKGRFDAPPGKHPRWPAAAIELPRPDLDRLRVQDPALTEVMEERCSIRSYDEDNPLTV
EELGEFLFRTARVRATGTDAEGLDVSSRPYPGGGAAYELEIYPLVRNVRGLDAGLYHYAPHGHRLLPVPA
SATALRWLMKASAAGMTGEATPQVLLVIATRFGRLAWKYQAMGYALTLKHVGVLYQSMYLAATAMRLAPC
ALGVGDSDAFAAATGLDYFEETSVGEFALGSLPAARRESTG