Home 

Gene Symbol:  
mur6
Organism:  
Streptomyces sp. NRRL 30471
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
11376..13328 [1], 1953 bp
Product Function:  
cyclodehydratase
Product Locus:  
 ADZ45319.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1953 bp
>mur6|ThioFinder1127 Streptomyces sp. NRRL 30471
ATGAGTAACGCGCATCCGCTCGTCAGCGTCCTGGGAGAAGGCCGACTACGCCAGGCCGTCGCGACGCACC
TGGCAGCTGATCCCCGGATCAGCTGCGGCCCGCCCGAAGGTCCGGCGGAGGACCCGACCGCCGTGGTCGT
CGTCGCGGACGCATGGCTGGAGGATTCCGTCGCGCTGGGTCCGGACGGCGCGGCAGCAGTCCTGCCGGTG
TCGACGGAGCTGGGGCATGTGGTCATCGGTCCGCTGACCAGGCCGGAAAGGCCGGGCTGTTGGATGTGCG
CCCGGCTTCGCCGCAGCCGTAACCATCCAGAACGCGATCTGGTGGTCAGGCGGAACCAGCAGGCCCTGGC
GAGCCGGCCATCGTCCTGGCTGACCAGCTTCGCCGCCGACGCAGTGGCCGCGCTGGTACATGACGAGATC
ACGGCCCTCGTGGCGGGGACCGGTCCACGTACGGAATCGTCATTCCTCCGGGTGTCGTTGGCAGATCTCA
CCGTCCGGACACACCGTGTGCTGCCCGACCCGCTGTGCCCCGTCTGTGGCGAACTGCCGGAGGACACAGC
CGAGGCCGGTGTGCTGCCGCTGACGCAGCGGCTCAAGGCGTCGCCCGGTGCCTACCGCACGAGGGCCGTC
GTCGACGCCCGTGAAAGCCTCCTGAGCACCTACGTGGACCCCGAGGCAGGGCTGGTCAGCGAGGTGCAGA
CGGGCGACGAGGGGGGTCTGCCGGTCGCCAAGGCTCCGCTGGCGATGCGTGCCGCCTCGGGGACCGAGGC
GGGTTGGGGGCGCAGTGACAGTTACCGGGTCAGCGCGGTGACTGCCGTGCTGGAGGCGGTCGAGCGGTGG
GGCGGGCTGCAGGCCGGCGGCAAACGCACTGCAGTGCGCGCCGCCTATCGAGAGGTTCGCGAACTGGCCG
TCGACCCGGTCACGCTGGGGCTGTACGACGACGAGCGTTACGCGGCTCCTGACTTCCCGTTCACACCGTT
CCATGACGCCCTCGAACTGCGTTGGGTATGGGCCTACTCCTTCCGCCGTCGGCGTGCGGTTCTGGTCCCT
GAGACCTACGCGTATTACGGTGCGCACGTCCTGGAGCCTGATGAGCCGCGACTTGCGTACGAGATATCGA
ATGGATGCGCGCTGGGGGGCTGCATCGAGGAAGCAACTCTCTATGGTCTCCTTGAGGTCGCCGAACGGGA
TGCCTTCCTCACGGCGTGGTACGGACGGCGGCCGCTGCCCGTGATCGACCTGGCCTCCGCCCACGACCCT
CGCGTGCGGTTGCTGGCGGCGCATCTTGAGGAGGAGAACGACCGGACGATCACGGTCCTGGACACCACGG
TGGAGCAGAACATCCCGTGCGTGTGGGCCATCGCCGTCAGCCGGCCCGGTGACACGGTGCGGGCGAGGGC
GGTGTGTGCAGGGGGTTCGCACATCGACCCGGAGCGGGCGGTGCTGAACGCGCTGTGCGAACTCGGCCCG
ATCCTCGCGAGCGTGGACCGCTCCTACGCACAGCGCCGGGAGCACGTCACCGCGATGACCAAGGACTCGC
ACCTGGTCCGAACGATGGGCGACCACTCTCTGCTGTACGCCGATCCGGAGGTCTTTCCCCGGCTGGCGTT
CCTGTTCGCCTCGCAGGAGCGTCGCTCCTTGCGGGAGATGGCGGCGAAGAGCATCCGCATCTCTCTTGAC
GATCTCACCCAGGATGTCCATCAGGTCGTCGGGCGTTACCTGGAGACCGGCCTGGACGTGTTGGTCGTCG
ACCAGACGACGTCGGAGCACCGCCGCGCAGCTCTCTCCTGCGCCAAGGTGATCGTGCCGGGCACGGTACC
CATGACGTTCGGCCATGGGATGCGCCGGGTACACGGCCTGCCGCGGCTCTTCGACGTCCCGCGTCTGCTC
GGCGACCGGAGCGCGCCCGCGACCATCGAGGATCTCAATCCCCACCCGCACCCGTTTCCCTGA
 Primer design

Protein Sequence:650 a.a.
>Mur6|ThioFinder1127 Streptomyces sp. NRRL 30471
MSNAHPLVSVLGEGRLRQAVATHLAADPRISCGPPEGPAEDPTAVVVVADAWLEDSVALGPDGAAAVLPV
STELGHVVIGPLTRPERPGCWMCARLRRSRNHPERDLVVRRNQQALASRPSSWLTSFAADAVAALVHDEI
TALVAGTGPRTESSFLRVSLADLTVRTHRVLPDPLCPVCGELPEDTAEAGVLPLTQRLKASPGAYRTRAV
VDARESLLSTYVDPEAGLVSEVQTGDEGGLPVAKAPLAMRAASGTEAGWGRSDSYRVSAVTAVLEAVERW
GGLQAGGKRTAVRAAYREVRELAVDPVTLGLYDDERYAAPDFPFTPFHDALELRWVWAYSFRRRRAVLVP
ETYAYYGAHVLEPDEPRLAYEISNGCALGGCIEEATLYGLLEVAERDAFLTAWYGRRPLPVIDLASAHDP
RVRLLAAHLEEENDRTITVLDTTVEQNIPCVWAIAVSRPGDTVRARAVCAGGSHIDPERAVLNALCELGP
ILASVDRSYAQRREHVTAMTKDSHLVRTMGDHSLLYADPEVFPRLAFLFASQERRSLREMAAKSIRISLD
DLTQDVHQVVGRYLETGLDVLVVDQTTSEHRRAALSCAKVIVPGTVPMTFGHGMRRVHGLPRLFDVPRLL
GDRSAPATIEDLNPHPHPFP