Home 

Gene Symbol:  
mur5
Organism:  
Streptomyces sp. NRRL 30471
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
9488..11383 [1], 1896 bp
Product Function:  
putative peptidase containing docking domain protein
Product Locus:  
 ADZ45318.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1896 bp
>mur5|ThioFinder1126 Streptomyces sp. NRRL 30471
ATGAGACCTCGGCTCAAGGACGACGCCTACTTCACGCGGGTGGACGAGGGCTTGGTCTGGCTGACCCCCG
CCGGCTTGCTGACCGTGAAGGAACCGTCCGTCGCTGCCATGGTGGAGAGACTTGCGCCACGGCTCAACGG
GCGCCACACGGTGGACGAGCTCACCGCGCGCCTGCCGGAGCGGACCCGCCGTCTGATCGTCGAGCTGCTG
GACGTGCTCGTCCGCCAGGGGCTGGTGGAGGACACCCGACCCGGCCGGACGCCCACCGCGAGTGCGGAAG
CGGACGCGGCTTTCGTGGAGCAGGTCACCGGTGACCCCGACGCCGCTGTACACGGCTACCGCAACGGCAG
AGCCCTGGTGATGGGGCCCGACCCGCTCCTCGCCCATTGTGTCGGGGCCCTGTCCGCAAGCGGCGTCACG
ACGGTGGCGAGGATTCTCGACGCGGGCGGTGCGGCGCCGGAAGCCGCCGTCCACGCCATCGTTCACGACG
GCATCGACTTCGCGCTGCAGCTCTTCGACTCCACGGGCCTGTCGCAGGCATCTGCCCTTGCCGGTGTCTG
CGCGGATCGTGACATACCGCTGGTTCAAGGGCTGGTCTCGGAGTCGGAGGTGCTGGTCGGGCCCAGTGCG
ACGGTCGACTGGACGTCTGTGTGGCGGCGACTGCGCGCCGAGGACAGGAAGCCGTTCGAGGCGGAGCCGG
GACCACCGACGGGTGCCGCCGGGCGCGTCCTGGCGAACCACATGGTGTTCCGGCTGTTCCGGTGCGTCAC
GGGCGCTGCCGGGCCCGAGGATCGGAGGCTCTTTTCCTTCGCCACGCGGACGTTGGAAACACGTTGCCAT
GATGTGCTGCGCCACTTCTCCGTCAGAACGGCGCGGCCCCAGTCCCGGGTGGATTTCCTCCGCACCGTTC
GCGAGCTGCGGCGGGGGAGGGGATGCACGGAGGCCCAGTTCTCCACGCGCGCAGTGCAGGCGATCGATGC
GCGGTTCGGTCCCGTCCGAGAACTGGCGGAGGACGAACTGCCGCAGCTGCCGCTCCGCCAGGCACGCGCG
CTCGTTGCTGCGCCCTCCTGGGCCGATGGCCCGGTGGTGGTGACCGCCTCCGGGCCGGACTTCGCCACCG
CGCGGTATCGGACGGCGCTGAAGGCCATCGGAACGTATGGCGCCATGACCGTCGATCCTCGGCGCTTGCA
CATGCGCAGCCGGAGCGGTGGCCGCCTCCCTGATGAACCCGATGACGTCATACGTGCGATCCGGGCGGGG
GAGGCCGACGCCCGACTGTGGGGAATCCGTCTCGACGACGCACAACCTTGCCTGGTTGATGCGCGCGAGG
CGTTCCCCGTGCTGTCCGAGGGCAGCACGCTGCCGACGGGGCTCGGCTTCGGCCTCGACTGGACGACCAT
GACGAGGGTCGCCGTCCTTGCGCAGTGTCGCGCCACCGTGCTCGCGGACCCGAGGGAGGTGACGGGACCG
CAGGTCGGGCAAGGGGTGATCGACACGGACCCGGTGAGCAGGCGCTACCGCCGGCTGCTCACCGCACTCG
GCCACGACCTCCGGCTCATCGACCTCAGTGGTCGGGCAGGCGTGCCGACGGTGGCGGTCCTGGTGAATGG
CGCCGCCGTCCAGGTGATGTGCAGACTCCGTCTGGTCGAGGCCGTCCGGGCTTGCCTGGAGGCCGTGCTC
GTGGCAGCGCAGTCGGGGCGACCGCTCTCCTGCACCGGCCGCAGGGTGCGGGAAAGCATGGCGCAGTGGT
CGCCGCCGCAGGACGCGTCCCTGGACGATGCCGTCAGCGCACTGCGGCAGACCGGGCAGACGCCTGTGCT
GGTTCCGCTGAACCATGATCCGGCGATGAACCGGATCACGCCCTATGCCGGGAACGTGGTGCTGATCAAT
GAGTAA
 Primer design

Protein Sequence:631 a.a.
>Mur5|ThioFinder1126 Streptomyces sp. NRRL 30471
MRPRLKDDAYFTRVDEGLVWLTPAGLLTVKEPSVAAMVERLAPRLNGRHTVDELTARLPERTRRLIVELL
DVLVRQGLVEDTRPGRTPTASAEADAAFVEQVTGDPDAAVHGYRNGRALVMGPDPLLAHCVGALSASGVT
TVARILDAGGAAPEAAVHAIVHDGIDFALQLFDSTGLSQASALAGVCADRDIPLVQGLVSESEVLVGPSA
TVDWTSVWRRLRAEDRKPFEAEPGPPTGAAGRVLANHMVFRLFRCVTGAAGPEDRRLFSFATRTLETRCH
DVLRHFSVRTARPQSRVDFLRTVRELRRGRGCTEAQFSTRAVQAIDARFGPVRELAEDELPQLPLRQARA
LVAAPSWADGPVVVTASGPDFATARYRTALKAIGTYGAMTVDPRRLHMRSRSGGRLPDEPDDVIRAIRAG
EADARLWGIRLDDAQPCLVDAREAFPVLSEGSTLPTGLGFGLDWTTMTRVAVLAQCRATVLADPREVTGP
QVGQGVIDTDPVSRRYRRLLTALGHDLRLIDLSGRAGVPTVAVLVNGAAVQVMCRLRLVEAVRACLEAVL
VAAQSGRPLSCTGRRVRESMAQWSPPQDASLDDAVSALRQTGQTPVLVPLNHDPAMNRITPYAGNVVLIN
E