Home 

Gene Symbol:  
mur3
Organism:  
Streptomyces sp. NRRL 30471
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
6994..8109 [1], 1116 bp
Product Function:  
dehydratase
Product Locus:  
 ADZ45316.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1116 bp
>mur3|ThioFinder1124 Streptomyces sp. NRRL 30471
ATGTGGCGGAGTTTCCACGTCCATTACTACGACCACGACAAGAGCGGCCTCCTTCTGGATGCCGTCCGTC
CCTTCCTGGAGCGGATAGCGCCGCAGGTGTCCGGGGCCCACTACCTCTTGCACTGGTTGCGCGGCCCGCA
CGTTCGTATCAATGTGAACGCTGAGCCCGAAACCTTCGCGGTGACCGTACTGCCTGCACTGGACGAGGTG
ATCAGGCCATATCTGGCCGAGCATCCGTCAACCGCAGTGATCGATGCCGCCGCGCTGGAGACCCAGCACA
CACGTCTTGCTGAGCTTGAACACGAACCGGGCCCGGTCACTCCGTTGCACGCGGACAACTCCGTCCATGA
GGCCGGCTACGACCAGCGGCTGCACGTTCTCGGCAGTGTGCAGGCCGCCGAGCTGCTCGCGGACTTCTAC
GATGCCACCACGCCGCTCGCCTTCGAAATGCTCGATCGCACGCACCGTCGTGGCAGCCCGTTGGCCGGGC
TGTGCTTCGACACCATGATCGCCACGGCACATGCGTTGTCCGGCGTCGGGCTGCGGCGCGGTTTCGTGTC
CTTCCGGTCGCACGCGGAAGCCTTCCTGTCCTGGTGGCCGGAGGCCGAGGGACTTCGGCAGGCATGGGAC
CGGCACTACACCGCGCACGCCGGGCAGCTCGCCGCACGCGTACGCCACGTCATGCGGGCAGTGGAGTCAC
CGACGCAGTCGGGAGGCATGGTGCGCCGCTGGGTGCAGGAGGCGGCTCCCTTTTTGCAGCGCGGGACCGA
GCTGATGACGGCCGGTGAGCTGTCCATGGATCCGCCCTGGGCGGGCCGCTACTCCGAGGACGACGAGCTG
ATCGCCGACATGGCGCGCAAGAGCGCGTTCCACAACCAGCCCCGGCCGGCCGGCGAAGCGGTCGACCAGC
TCTGGTTCGACCAGTACCGGCTGATCCTGAACTACACCTATCTGCAGTTGACCCGCTCGGGGCTGTCACC
GGTGGAGCGGTTCCTGTTGTGCCACCTTGCGGCGAACACCGCCGAGGACCTGTTCGGCGTCGCGGCCGCC
GAGGTGCGGCTGCCCGCGCCCGGCGAATTGCTGCGCACGGCCGCGAGCCCGCGGGAGTCCCCGTGA
 Primer design

Protein Sequence:371 a.a.
>Mur3|ThioFinder1124 Streptomyces sp. NRRL 30471
MWRSFHVHYYDHDKSGLLLDAVRPFLERIAPQVSGAHYLLHWLRGPHVRINVNAEPETFAVTVLPALDEV
IRPYLAEHPSTAVIDAAALETQHTRLAELEHEPGPVTPLHADNSVHEAGYDQRLHVLGSVQAAELLADFY
DATTPLAFEMLDRTHRRGSPLAGLCFDTMIATAHALSGVGLRRGFVSFRSHAEAFLSWWPEAEGLRQAWD
RHYTAHAGQLAARVRHVMRAVESPTQSGGMVRRWVQEAAPFLQRGTELMTAGELSMDPPWAGRYSEDDEL
IADMARKSAFHNQPRPAGEAVDQLWFDQYRLILNYTYLQLTRSGLSPVERFLLCHLAANTAEDLFGVAAA
EVRLPAPGELLRTAASPRESP