Home 

Gene Symbol:  
HMPREF9601_02025
Organism:  
Propionibacterium acnes HL030PA1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
166059..166982 [1], 924 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 EFT77538.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:924 bp
>HMPREF9601_02025|ThioFinder724 Propionibacterium acnes HL030PA1
ATGTCTGATCCTGGCGGCTGGCGGGCGCTCCATATTCACTTGCCTCCCTCGGTGCAGTCCGAGTACCTAG
CTGACGTGATTCTTCCCTCGATGTCAGCCTTGATGCCAGAACATGACTACTTCTTCCTCCGATATTGGCA
GGGGGGATCACATCTCCGGCTTCGGCTCCGTAGCACTCCCGAGCGCCCCCTAGATGATGAGGCTATCAAC
GAGGTTGCATGCCATCTCCGTAGCCTTCTCCCGGCGTTGTCAGACCAAAAGCGCGCGGAGTACCGCTATT
CGCAATCGCTTCAGGATCAGTTAGCCGAAATGGAAAGGGCTGATTGCCTTCCCCTAGAGGCGGTTGGGAC
CGTGGTAGAGCGCCGGTACCAGCCTGAATATAGAAAGTATGGCGGATCGGTCGGAGTATCCATTGCAGAG
GATGTTTTCTGTAGTACTAGCCGATCTGTCCTTCGCATTCTAAGTGAGCGACCAACTAGCCACCGACAGC
CCTTGGGGTATGCTTGCCAAGTTTTCATCCAGATGCTGGGCTGCTTAGGGCTCGCAACTTCGCAGGTTGA
CCAGTTCCTCACCAGATATGCGCAGTGGTGGACCCCTTACTCAATGGCCGCTCGCCCTGAGATCTTAGCG
GCGCGTCTCTACGCCAACTTGTCAAGCGTGGTGGCGGACCTATGGGCCGCAAGTGAGCCCAACGGAATGT
TCTCGGTTCCGGCTCTCAATGCTTATACCCAATGGTCACGGCGACGGTCGTCCGCGAGAAATACCAGCGT
AAAGATAGACCCAATGTTTCTATCTTGCTTAGCGAACTACATTCACACAACCAATAACCGACTTGGGCTC
CCACCCGCCCTAGAATCGACAGCGGCATATCTTGTCCAACTTGGATTCCGATCGGTGGCTGTCAGGGGGG
AGAAAGTGCGATGA
 Primer design

Protein Sequence:307 a.a.
>HMPREF9601_02025|ThioFinder724 Propionibacterium acnes HL030PA1
MSDPGGWRALHIHLPPSVQSEYLADVILPSMSALMPEHDYFFLRYWQGGSHLRLRLRSTPERPLDDEAIN
EVACHLRSLLPALSDQKRAEYRYSQSLQDQLAEMERADCLPLEAVGTVVERRYQPEYRKYGGSVGVSIAE
DVFCSTSRSVLRILSERPTSHRQPLGYACQVFIQMLGCLGLATSQVDQFLTRYAQWWTPYSMAARPEILA
ARLYANLSSVVADLWAASEPNGMFSVPALNAYTQWSRRRSSARNTSVKIDPMFLSCLANYIHTTNNRLGL
PPALESTAAYLVQLGFRSVAVRGEKVR