Home 

Gene Symbol:  
HMPREF9601_02024
Organism:  
Propionibacterium acnes HL030PA1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
164159..166048 [1], 1890 bp
Product Function:  
lantibiotic dehydratase
Product Locus:  
 EFT77537.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1890 bp
>HMPREF9601_02024|ThioFinder723 Propionibacterium acnes HL030PA1
ATGCTTGCTATCCTCAACAGCACCCTGCGCGTTAAACGCGATATAATCCAGTTCATTGGAATTCCACCTG
GGGAGTGGCGAGGTGCACCGAGCATTCCCGAGGAGCGCCTGCTAACTATCCGCAAGCGCGAAGATATGAT
GTCTGTTCTTAAGCTCCTAATGGGCGGCCCAAGATCAGTCGGTGACCTCATTATTGCCCTTAATGACCAA
GGCATAGATGAATCACACGCAACTAATCTTCTCAGCAGTTTGAGTACAGCAGGGATAATCTTCTTTCGGC
TCCCAGTAGATGACCATGACGTACACTATGTACAGACTGCGTGTACAGCGCTAAGGTTAACCAAAGATGA
GTCACTTCGTGCCGCTTTCCAAAGTCTGGCGAACGCTGAAAAGGAGTTCCCCACAGCGTCAGTCGCCACG
CGTCACGACCTTCTCCTCAGCATCAAGGATTCCGTGAATACTGTCGCGTCGGCACATGATGTGCCGGCCC
CACCGGACAGCGTACTCAAGAGCCCTTTGTATGAGGACCTCCCCGCCACCGCGGCACCCCAGACATGGGA
TTCGAACACGGTTGAGAGATCAGCCCGCGCACTCAGGAGCATCTGGCTACTGAGCGATTTAATGGATAGC
TCTCAACGCCGACAGTTGGGCCTCTCCCAGTTCATAGCAGACATGAATAATGGCGCGCCAGTTACTTTTC
TGGATTTCTTCGACTCGTTTTCGCGCCTTAGCATTCGTGAGCGCCAAGGAATCCTGCGCGGAGAAAACTC
ACCGCAAATCGCCCGTTTCGCTCAGCAATATAGTGAAGCATTGCTTAAAATTCGCGATGCCGTTAACTAC
ACGCAGGACGAAGCCCACCTTGAATCTCAGGTAATTCTCGATGCGATCACCAATATTGATGATTTCCGAC
CGACTAAGTCGGTCACAATTCGAGGACAATTCACAACATCGCTCACCTCCCATATAAGCCAACTGATAAT
CAACGGTGTTATGACGGGATACGGTACATACATGTCCCGATTCGCAACATTTGTAAACCCATCAGGTACT
TGGAGTCTAGTCGACGGGATTCGGAGACATCTATCCGATCATTTTCCAGGTCAATGTGATTTGAATTCCG
TACTGGGATTCAACTTCAATGTTCATCCGCAAATGACAGCACATAGTATCGCCTATCCTGGAGTAGTTCC
TGTGCTTAATGGTGCCAAGACACATTCGATTCAGGATTTAATACTGATTCCAACTGCTGAAGCAGGTCCG
CGCCGCGTCGCTATCTTTGATAGAGCAGAGAACGAACTTATCGACCTCCAGCCCATGAATTTCATGGTTC
CTTTTGGGGTGCCTTTGCTGTATCGGACTCTAGAGTTCCTGTGCCCATCGACCAGATACCTATGGAACCC
AGCTCAAGACCTTCTGGATATCCCAATGATAGAGAACAGTTGCCCTCGGATTTACTTTGACGACGTAGTG
GCTCAACGCCGTTCCTGGACGTGCAGCGCCGAGACGCTCCCGTGTCCCCCAGAGAAACTCTTTAGGGGTG
ATCTTGCTGCTTTGCAAGCCTTCGACTCGTGGAGACTATCAGCGAGGGTACCCAGACATGTCTTTGCCCT
AGTACAAACGGCTACGGAAAGACAAATTTTTTCCGGAGCGGCCGACGCGCCAACCTTGCTCTCCGAATAC
AAGCATCTTCGGAGAGCAAGTGTGCATAAGCCAATCTACCTGGATCTACGAAACCCACTTCTAGTCCGTT
CTCTCGCGAAGGTGATCATGTCCAGGCCCGAACTATATGTCACGTTTTCCGAGTTCCTCCCATCGGAGGC
CGATTACACGCAGAACGGAAGCTGCCCCAGTTACGCAGAGGAGTACTTCATTGAACTGTGTGCCGAGTGA
 Primer design

Protein Sequence:629 a.a.
>HMPREF9601_02024|ThioFinder723 Propionibacterium acnes HL030PA1
MLAILNSTLRVKRDIIQFIGIPPGEWRGAPSIPEERLLTIRKREDMMSVLKLLMGGPRSVGDLIIALNDQ
GIDESHATNLLSSLSTAGIIFFRLPVDDHDVHYVQTACTALRLTKDESLRAAFQSLANAEKEFPTASVAT
RHDLLLSIKDSVNTVASAHDVPAPPDSVLKSPLYEDLPATAAPQTWDSNTVERSARALRSIWLLSDLMDS
SQRRQLGLSQFIADMNNGAPVTFLDFFDSFSRLSIRERQGILRGENSPQIARFAQQYSEALLKIRDAVNY
TQDEAHLESQVILDAITNIDDFRPTKSVTIRGQFTTSLTSHISQLIINGVMTGYGTYMSRFATFVNPSGT
WSLVDGIRRHLSDHFPGQCDLNSVLGFNFNVHPQMTAHSIAYPGVVPVLNGAKTHSIQDLILIPTAEAGP
RRVAIFDRAENELIDLQPMNFMVPFGVPLLYRTLEFLCPSTRYLWNPAQDLLDIPMIENSCPRIYFDDVV
AQRRSWTCSAETLPCPPEKLFRGDLAALQAFDSWRLSARVPRHVFALVQTATERQIFSGAADAPTLLSEY
KHLRRASVHKPIYLDLRNPLLVRSLAKVIMSRPELYVTFSEFLPSEADYTQNGSCPSYAEEYFIELCAE