Home 

Gene Symbol:  
HMPREF9601_02029
Organism:  
Propionibacterium acnes HL030PA1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
169998..171593 [1], 1596 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 EFT77542.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1596 bp
>HMPREF9601_02029|ThioFinder728 Propionibacterium acnes HL030PA1
ATGAAGGGTATAATCAGTGGTGAACAGGTGGGAAATGCAGCTCGCTTTGACAAGCAGTTCAGGGTCCCTC
GTCGGCCGAGCAGGCGGCTCGGTGTCGATATTGAGATCCGTGAGGATGCAACAATTCTTTGGGGATCAGA
TCGTCTGCAGACATTTACAGGAGGAATGAAACCTTCACTGATTGAGGATATTTTACGAGCGTGCGACGGA
ACTAAGACGGCACGTGAGCTCGCCTCTGTATGTGATGTTACGGAGCCCTTGATGGACAAGATAGTGGCCC
TTCTCTGGGTCTCGGGTGCTATTGAGGAGGCGGGCCCGACCGATGTTGAAAGTTCTCCGCTTGGGGTCCT
TTTGTCTCGCCTTGGGAACGCAACTGGGGCGAATGCTAGCTGGCAGGAAGCTCAGCACAGAATTAACAGC
ATGCCGATCTGTGTTATGCCCCATTCGGAACTTGGAACGGAGGTTGCGGGCGCGCTTGCTGGCACCTTTG
AGGTTATCAATGAAGAGGCAGCTTTTGAACGCGGCGTGGTTCTATTCATCTTTATCGAAACCGCGTCGTC
TAAGATCGAACAGCATCACAAATTTGATGAACTGACAAAGAGAAGAGTGCTATTGGTTAGCGCTGCGGGT
GACGAAGTTGTAGTGGGGCCGCTTTATGACCAGGCTATAACGCCCTGCCTTCGGTGCTGTTCGTCATCGA
GGATCAAGCTGGATCGGGGTGCCTCGAGCCCGGCGCAGCTTCGTCTCATGGCTGGAATTGTCTCGCATCA
TATTGTTGCGTTGGTAAGCAGGGCGTTACTCTCACCGCTGCCCACGGATTCCTTGGCGCTGAATGTGGTC
ACTGGTGTCCAGCGCTACTCTCCCCCGGTGTCCAGACCGGGTTGCCCCGAATGTTCGCATGCGATCCCAG
CTATTGCTAGTGAGCCGACGGTCGGTGCCGTGTACGAGGCTTCCGTAGCACTCCCTCCGCGAGAATTCGT
GAATGTAAGGGACTATCAAGCCCACTTCTTGAGCGCAAATCAACAACTTCAAACGAAATTTAAGTCATGG
GGAAAAAGGGAAAAATTCCCTTTGCCTGACATTAATATTTCAGACCTACATATACAGATTGACGACCTTC
TTTTTTTAGCTGCTGCCCTTAGGTTTGGGTTCGGAATAGACCCGGAGCGGACCACTTCAAAAATAGCGAA
GCGCTGGACGGCCTCTGGTGGAAACATTGGCTCGGTAAACGCATTCGTGAGCCTTCCTGCGATGGTAGGG
CACATTCCCAGTGGGATTTATGGATATTCAGTTAGCGATCATTCCCTAGCCAAAGTTAGTCAGGAGTTGA
TTTCGGCGACTGACATCATGATCGCGGCTTCTGCCGACCTACGGAAGATCGCTTCTAAATATGGGACATT
CGGCTTGAGGATCGCGATTATGGACGCCGGGTGTGCCCTTTCAACGGTGCGTCGTGTCTGCCGGGAAGTA
GGCCGTACATTTTCGATGTGGAGCGCTGACCTCGACGCTGGGTCTATTAGCGAGATGCTGCATCTTTCAA
GTGCGCGTGAGCCTATTATTGGAGTTTCAGTGCTGGGAAAGGGGCAACGAGGGTGA
 Primer design

Protein Sequence:531 a.a.
>HMPREF9601_02029|ThioFinder728 Propionibacterium acnes HL030PA1
MKGIISGEQVGNAARFDKQFRVPRRPSRRLGVDIEIREDATILWGSDRLQTFTGGMKPSLIEDILRACDG
TKTARELASVCDVTEPLMDKIVALLWVSGAIEEAGPTDVESSPLGVLLSRLGNATGANASWQEAQHRINS
MPICVMPHSELGTEVAGALAGTFEVINEEAAFERGVVLFIFIETASSKIEQHHKFDELTKRRVLLVSAAG
DEVVVGPLYDQAITPCLRCCSSSRIKLDRGASSPAQLRLMAGIVSHHIVALVSRALLSPLPTDSLALNVV
TGVQRYSPPVSRPGCPECSHAIPAIASEPTVGAVYEASVALPPREFVNVRDYQAHFLSANQQLQTKFKSW
GKREKFPLPDINISDLHIQIDDLLFLAAALRFGFGIDPERTTSKIAKRWTASGGNIGSVNAFVSLPAMVG
HIPSGIYGYSVSDHSLAKVSQELISATDIMIAASADLRKIASKYGTFGLRIAIMDAGCALSTVRRVCREV
GRTFSMWSADLDAGSISEMLHLSSAREPIIGVSVLGKGQRG