Home 

Gene Symbol:  
HMPREF9601_02027
Organism:  
Propionibacterium acnes HL030PA1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
168613..169380 [1], 768 bp
Product Function:  
bacteriocin biosynthesis docking scaffold, SagD family
Product Locus:  
 EFT77540.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:768 bp
>HMPREF9601_02027|ThioFinder726 Propionibacterium acnes HL030PA1
ATGCGGAAGGCTGTTCTTAACGGTCTTTTAGAAGTCGTCGAGCGAGATGCTATTGCTTTGACTTGGTTGC
ATGAGTTGCCCTTGCCCAGAATCGCGGCTAGCGAGGCCGGTGAGTTCCCGCCGGAAGCGCTAGCCAGTTG
GAAGTCATATAGGGATTACGGAATCGAGACCCATCTCTTTGACGCAACGACGGATTTTGGGATTCCGGTG
ATCTTTGCGCTCCAGATATCGGATCAGGATGACGACATCGCTCAGCTCGTAGGCGCTGCATCCGCTTTGG
AACCCGCTGAGGCGCTGACTAAAGTATTCAGGGAAATGGCATCGATCCGAATAGCACTACGCGCCTTTCT
CGCCCAGTCCACATCGATTAAGATTTACCCCGATGTGGCTAACGTGACAGGGGGTGCCGCCCTCATGGGC
CAGCGCGCGTACCGAGATGCATTTTCCTTCCTCATTAACAGCGAGCGCGAAACGTCACCGTCGCGGATGC
CTAACCTCCTAGAGCTGAATGATGATCCACTGCGCGAGATGATTATTCGAATACGCCTGGCTGGCGCTGA
AGTTATCGCCGTCGATATCACGACGGACGAAGCGAGGTCAGTTGGTGCAAGAGTAGTGAAGGTTTTGGTC
CCAGAGGCGGTTCCACTCTCCTTTGTTCACCGAGAGAGGTATTTAGATACTCCTCGGCTCATATCCGCGC
CTAATAGCATGGGATATTTGGTTGACACAGCGCCTACGTTCAACCGGAACATTCAACCTTTTGCGTGA
 Primer design

Protein Sequence:255 a.a.
>HMPREF9601_02027|ThioFinder726 Propionibacterium acnes HL030PA1
MRKAVLNGLLEVVERDAIALTWLHELPLPRIAASEAGEFPPEALASWKSYRDYGIETHLFDATTDFGIPV
IFALQISDQDDDIAQLVGAASALEPAEALTKVFREMASIRIALRAFLAQSTSIKIYPDVANVTGGAALMG
QRAYRDAFSFLINSERETSPSRMPNLLELNDDPLREMIIRIRLAGAEVIAVDITTDEARSVGARVVKVLV
PEAVPLSFVHRERYLDTPRLISAPNSMGYLVDTAPTFNRNIQPFA