Home 

Gene Symbol:  
HMPREF9601_02026
Organism:  
Propionibacterium acnes HL030PA1
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
167228..168061 [1], 834 bp
Product Function:  
conserved hypothetical protein
Product Locus:  
 EFT77539.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:834 bp
>HMPREF9601_02026|ThioFinder725 Propionibacterium acnes HL030PA1
ATGGAAAAACCACCCAGCTGGCCTCTTCTATGGAACGCGGGTTTCGCGGGCTTGAAGCTTTCCACGATAA
GCAAACAATTGTTCACCGCGTCATATCCATGGATGGTAAAGTGGGCGCTACAGGCATCGGCTTGGACGGA
CGACGAACGCCTTCTGGCTCTTACGAAACTTCTAGTTGCCCACGCTGATGCAAGCCTTCCACCGGTCGAT
AAGACTGAAATGCTCGGCCGCCTCCCTTTGAAGTTGAGCTTGCGACTGATCACATATCGTTCCCACTACG
AAAGCATCCGCGCTCGCACGATTGACCCGAAAGCGATGGATACTGCGGTTAATCGGGCCTTCATGAAGTA
TCAAGACGAGCTCCTGCGATGGTCCCAGTCGTTGACATGCTCGTCGAGCTATCGTGAGAAAGAATGGAGT
AATCCCAACCTTTCAGAATGGAGCGCCATCATTTATTGCCATCTCCCACAAATTAGGCAACTCCTCAGCG
GGGGAGGATTAACTGTCGCGGGCCCGACACGCGAGGATATAGAAGCCTCCTTAGGTCACAGTATTCCTGA
TACACGATTTCACGAGCGTCTTGACCCCGCCATGCAGTATTATCTCAATCATGACCAAGACTTCACGGCA
TACAGATTCTGCACGGGTTTTTTGTACAGCAACCTGTACTCGCTAGGAATACCGTTGAGGCTGCGCTACC
TTGTCTGTGGGTTGGCAGCACGTTTCAACGAGGAGCTGTCGGACACGACTTGGCGCGATTTACGGGATCT
CTTCCACGAGGCTGCTACTGTTGCATATTACACACGCGACACAGACGGGAGCGGGATTAGATAA
 Primer design

Protein Sequence:277 a.a.
>HMPREF9601_02026|ThioFinder725 Propionibacterium acnes HL030PA1
MEKPPSWPLLWNAGFAGLKLSTISKQLFTASYPWMVKWALQASAWTDDERLLALTKLLVAHADASLPPVD
KTEMLGRLPLKLSLRLITYRSHYESIRARTIDPKAMDTAVNRAFMKYQDELLRWSQSLTCSSSYREKEWS
NPNLSEWSAIIYCHLPQIRQLLSGGGLTVAGPTREDIEASLGHSIPDTRFHERLDPAMQYYLNHDQDFTA
YRFCTGFLYSNLYSLGIPLRLRYLVCGLAARFNEELSDTTWRDLRDLFHEAATVAYYTRDTDGSGIR