Home 

Gene Symbol:  
Caci_3693
Organism:  
Catenulispora acidiphila DSM 44928
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4139718..4140761 [1], 1044 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003114436.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1044 bp
>Caci_3693|ThioFinder327 Catenulispora acidiphila DSM 44928
ATGTCTGACATCACTCCCACCGACGCCGGCCCGTGGCAGGCGATCCACGTCTTCTACGCCTCGAGCACCA
GACCGCTGCTGACCGAGTGCGTCCGCCCGATGGTGGACGGGCTGGTCGCGGACGGGCTTGTGTCAGGGTA
CTTCTTCATCAACTACTGGCTGGAGGGTCCGCACCTGCGCCTGCGGCTCAAGCCCTCCAGCATGGCGGCC
GTCGACCCGGTACGCCGGCGCGCGAGCGCCGCGATCGAGGACTTCCTGCGCACCCGGCCGGCGCTGTTTG
AGGTGAAGGACGGCTTCTTCGGCGAGCTGTACGCGACGCTGTTCGAGCTCGAATACACCCCGGAGGAACG
CGAGCAGCTCACCGGCGCCGACGGAGCGATGCGGCTGCGGCCGAACAATTCCCACAGCTTCGAGGCGTAC
GAGCCGGAGTACGGCAAGTACGGCGGCCCGGCCGGCATCGCCTTGGCCGAATGGCATTTCCAGCACTCCA
GCGATCTGGTGATGGAGCTGGTCCGGACCATGAACGTGCACCTGCGCACGGTGCTCCTCGGCTTGTGCGC
GCAGCTGATGACGGTCATGGCGGGCTGCTTCATCCCGGACGACGAGGCACTGGTGCGCTTCCTCGAGCGC
TACCACGCGTTCTGGGACGCCGCGTTCCACACCACTGATCTCACCGCCGCCAAAGGCTACGAGCACGCCT
ACGACCAGACCGCCGGCGTGCTCGGCCCGCGCATCCACTCCATCCGCCGCGAGGTGGCCGAGGGTCGCGG
CGAGCAGCTGCCCGGCTTCCTCGGCGCGTGGGCCGCGCACTGCACCGAGCTGCGGGACCGGGCTCAGGCG
CTGGCCGACCGGGGCGAGCTGGTGTTCCGCTCCTGGAGCGGCGACGAGCTGTTCCAGCCGGACACCTCCG
AGCAGGCGTTGGCGATGCTGTTGTCGCCGTATCTGCACATGACCAACAACCGGCTGTCGGCGACCGTTCG
CGATGAAGCCTTCCTGTCCTACGTCCTGGCCCGGGCTCTGCGCGAACAGGCGGTTCCGCGGTGA
 Primer design

Protein Sequence:347 a.a.
>Caci_3693|ThioFinder327 Catenulispora acidiphila DSM 44928
MSDITPTDAGPWQAIHVFYASSTRPLLTECVRPMVDGLVADGLVSGYFFINYWLEGPHLRLRLKPSSMAA
VDPVRRRASAAIEDFLRTRPALFEVKDGFFGELYATLFELEYTPEEREQLTGADGAMRLRPNNSHSFEAY
EPEYGKYGGPAGIALAEWHFQHSSDLVMELVRTMNVHLRTVLLGLCAQLMTVMAGCFIPDDEALVRFLER
YHAFWDAAFHTTDLTAAKGYEHAYDQTAGVLGPRIHSIRREVAEGRGEQLPGFLGAWAAHCTELRDRAQA
LADRGELVFRSWSGDELFQPDTSEQALAMLLSPYLHMTNNRLSATVRDEAFLSYVLARALREQAVPR