Home 

Gene Symbol:  
Caci_3692
Organism:  
Catenulispora acidiphila DSM 44928
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4137011..4139725 [1], 2715 bp
Product Function:  
Lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_003114435.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2715 bp
>Caci_3692|ThioFinder326 Catenulispora acidiphila DSM 44928
GTGACGTACCTGGAGTCGGCGTTCATGCTCAGGGTCGCCGCGCTGCCCTTCGCGATGCTGGACGTGCTGC
GCAGCCCGGATTCGGTGCGGTGGGCCCGGGAGACGCTGGTTCTGGAACGGGAACTGGGCCGGGCCGGACG
CGCGCTCAGCGATCCGATCGGCGCGCGGGTGCCCGCCGTCGAGGCCGAGCAGGACCGGCGGCGCCTGCTC
GCGCTGCGGCGCCAAGCCTTCAACAACCAGCTGCCCGGCGATCTGCCCGGCGCGCGCCGTCTGGCCGCTA
CGCTCGGCGGCCCGACCGGCGAGGCGTTGAGCGCCTGGCTTGAGGACCGCGAACGCTTGGAAGCCGTCCG
GCGGGCCGGCAGCTCCCGGTTCAGCGAAGAGCTGGAGGCCGGTCGCGCCGGCCTGCGCGCGCTGTGTGGC
GAGGATCGCCTCCAGCTCGGGCTGCTGCTGGCCTCGCCGACCCTGGACCGGCAGATCGGCTCCTGGATGC
GCGGCGGCAAGCAGGACAAACGCAGCCGCAAGATGGAGCGCTCACTGCTGTCCTACCTGTACCGCACGGC
TGCCAAGACCAGCCCGTTCAGCACGTTCACCGGGGTCGCGCTCGGCCGCTTCGAGCTCGAGGCGGGTCCG
GACACCTCGATCAGCGGTGTCTGGAGCAGCCATCCGCGGCTCAACGTCGTCGCCCTGGCCCGGCTGGCCG
AGGCCGTGACGGGCAACGACCGGCTGCGGGGCGACCTGCCGGTGTCCGCGGCCTCGGGATGGGACGCCGA
CGCCGACCGCGTGCGGTTCGTGCGCCGCTCGCGTGATGCCGGCGGCGACGACGCGGCGGTGAGTTTCGAC
GCCGCGCGCGACCGGCTGTTCTTCCTGCGCCGCAGCGGCGCTCTGGAGGAGTTGCTCGGGCATCTGCGCG
GCCGCGGTTCGGTGCGCTATGGGGAACTGGTCGATCTACTCGCCGCCCGGCAGGACGCCAGCCGGTCGGA
GGCCGACCACTACCTCGGCGCTCTCGTGCAGCTGGGCATCCTGCAGCTATCGGTGTTGGACATCGATGTG
CACAGTCCTGATCCGCTGCGGGCCTTCCAAAACGCCCTGCGCGGGATCGAGCGGCCTTGGGCCGAACATG
CCGCCGATCTGCTGGAGCACCCGGTCGCGCGGATCGAGGCGTACGCCGCCGCGGGCGTCGACAAGCGCCG
GGCGCTGATCGCCGGAGTACGCGACGATCTCACCGAAGTGCTCGCAGCTTTGGGTGCGCCGGAGGGGTCG
CTGCCGCTGACCCTGTTCTACGAGGACGTCCGTGCGCAGGATGCGTCAGTATTCTGCGAAACCGGGCTCT
GGGACCGGGTCGCCGCCGAACCGCTGTCCCGGATGGCCCGGATCCTGCCGGCCTTTGACATCGCCCTGCC
CCAGCAGTTGACGCTCAAGGGCTTCTTCCTGGCCCGACACGGCGTCGCAGGCCACTGCGACGACATGCTC
CGGCTGGTCCACGACTTCCACGAGGACATCTTCGACCAGTATCTGCGGCTCACCGCCGACCGCCCGGCTC
TGGGCCCGGACGGCGACCCGACGCCGGAGGAGAACTGGCTGCGTCTGCCCGAGATCGATGCGTTGGACAA
GGCGCGCAAGGCGTTCGTGACCGGGATGAGGGCGCGCTGGGCGGCGCTGCCGCCGGGCGCCCCTGAGCTG
GACCTCGGCGAGGAACTCCTCGATGAGGTCGCGGCATGCCTGACCCCGTTGGGCCGTTCGTACGCGCCGC
AGAGCCACTTCGTTCAGCTGGCTGCGAACCGGCCCGAGCCGCTGGCCGTCCTCAACGACTCCTTCGGAGG
GCTCTGTTTTCCCTTCACCCGCTTCACGCACTGCTACGACGGTGACGAGCAAGCCCGGCTGTCCGATCAG
CTGCGCGCGGACCTGCGCCGGCGGCAACCCGACGGAGCCGTCTTCGCGGAGATCACCGCCGGAGCCGCGA
CGACAAACCTCAACCTGCACGGCAGGCTCACCGACTACGAGATCGTCTGCCCCGGGGAGTCGAGTTCGGC
CGAGGGCGACGCCCGGATCGAGCTGGACGACCTGTGCCTGGAGCACGACCCGGACGACGACCGGCTGATC
CTGCGGTCGCGGCGGCTCGGCCGCGAGGTGATCCCGCTGTATCTGGGCTACCTGCTGCCGATGGTGCTGC
CCGAGGTTCCCCGAACCCTGTTGCTGCTCTCGCCGACGTCCAGGGCGTTGCCCGACGTGTGGCGCGGCGT
CCCGGAAGGGCCGCAGGACGATGGCGTGATCGTCCGACCCCGCGTGCGCTACCGCAGCCTCGTGGTGAGC
CGGCGGAGATGGGCAGTCCCGGCCGACCGCCTGCCGGCGCGCGGCGCGGCTTCGCCGGATGCCGACTGGT
TCCTGAGCTGGCAGCGTTGGCGCACCGCACACGGGCTTCCCGACCGGGTCTTCGCCCGAGTGCGCCATCC
GGATCCAGGCGCCGGAGGAGCGTGGTTCGGTGGGGACAAGCCGCACTACGTCGACTTCGACAGTGCCCTG
TCGCTGATCGGCTTCGAAGGGCTGCTCCAGACCGGCGACCATGTGACGTTCGCGGAGATGCTGCCCGCGC
CCGAGGACCTGCACGTGGTCTCCGACCGCGGTCGCCACGTCGCCGAACTTGCTGTGGAGATCATCCCGGA
CCGAGTCCCGGCACGGCCGGGCGCCGCGAGGCATCCCGGAGGCGTCCATGTCTGA
 Primer design

Protein Sequence:904 a.a.
>Caci_3692|ThioFinder326 Catenulispora acidiphila DSM 44928
MTYLESAFMLRVAALPFAMLDVLRSPDSVRWARETLVLERELGRAGRALSDPIGARVPAVEAEQDRRRLL
ALRRQAFNNQLPGDLPGARRLAATLGGPTGEALSAWLEDRERLEAVRRAGSSRFSEELEAGRAGLRALCG
EDRLQLGLLLASPTLDRQIGSWMRGGKQDKRSRKMERSLLSYLYRTAAKTSPFSTFTGVALGRFELEAGP
DTSISGVWSSHPRLNVVALARLAEAVTGNDRLRGDLPVSAASGWDADADRVRFVRRSRDAGGDDAAVSFD
AARDRLFFLRRSGALEELLGHLRGRGSVRYGELVDLLAARQDASRSEADHYLGALVQLGILQLSVLDIDV
HSPDPLRAFQNALRGIERPWAEHAADLLEHPVARIEAYAAAGVDKRRALIAGVRDDLTEVLAALGAPEGS
LPLTLFYEDVRAQDASVFCETGLWDRVAAEPLSRMARILPAFDIALPQQLTLKGFFLARHGVAGHCDDML
RLVHDFHEDIFDQYLRLTADRPALGPDGDPTPEENWLRLPEIDALDKARKAFVTGMRARWAALPPGAPEL
DLGEELLDEVAACLTPLGRSYAPQSHFVQLAANRPEPLAVLNDSFGGLCFPFTRFTHCYDGDEQARLSDQ
LRADLRRRQPDGAVFAEITAGAATTNLNLHGRLTDYEIVCPGESSSAEGDARIELDDLCLEHDPDDDRLI
LRSRRLGREVIPLYLGYLLPMVLPEVPRTLLLLSPTSRALPDVWRGVPEGPQDDGVIVRPRVRYRSLVVS
RRRWAVPADRLPARGAASPDADWFLSWQRWRTAHGLPDRVFARVRHPDPGAGGAWFGGDKPHYVDFDSAL
SLIGFEGLLQTGDHVTFAEMLPAPEDLHVVSDRGRHVAELAVEIIPDRVPARPGAARHPGGVHV