Home 

Gene Symbol:  
Caci_3691
Organism:  
Catenulispora acidiphila DSM 44928
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4135359..4137014 [1], 1656 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003114434.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1656 bp
>Caci_3691|ThioFinder325 Catenulispora acidiphila DSM 44928
ATGGGATTCGCCCACGAGTACGCCACCGCCGTGGCCTGGCGCGGCAGGGTCCTGATGGAACCCGCCGACT
TCGTCCCGAACTGGGCGGACAAGCCACGGCGCGCCAAGTACTACCCCGGCGCGCTCGGTTTTCCGCTGCC
GGACACCGAGGACGAGGCCGCGGCCAGCGTCCAGAAGGGACTGTTCGATCCGGCCGGTTCGCAGCCCTTC
ACCCTGAGCCTGCTCGGCGGCATGCTGCGCGACTCCTACGGACTGATCGGCCGCCGGCTCGGCGTGCAGG
CGAACACCGACCTGGCCGCGCTGCCGTCGTACAAGGACGCGAACTGGTCGCGGGGAACCGCCTCGGGCGG
CGGCCTGTACCCGATCGGCGTCTACTGGTTGTCCGGTCCCTCCGGGCCGCTTCTCCCCGGCGCCTACCAC
TACTCGCCCGGCCATCACGCGATGCAGCGGCTCGTCGTGGGCGACCCGACCGGCGAGGTGCGGGCCGCGG
TTGGCGACGAGGCGCTCACCGCGGACACCGACCAGTTCCTCGTCCTGGGCATCAAGTTCTGGCAGAACGC
CTTCAAATACAACAGCTTCTCCTACCACGCGGTGACGATGGACGTCGGCACGGTGCTGCAGACGTGGCGG
ATGTGGGCGGGAGCCAGAGGCCTGCGGATCGACCCGCTCCTGTGGTTCGACGAGCAGCGCCTGAGCCGCC
TGCTCGGGGTGTCGACCGAGGACGAAGGGCTGTTCGCGGTGGTTCCCGTGCGGTGGGACGCGCCGTCGGC
GCCCACCGCCGAGCCGGCGACCGAGCGGCTGACTGAGCCGCCGAACGAGCGGCCGACCGAGCCGCCGATC
CAGGTGCGGCGCACCGACCAGGAGCGTTCTCGCACCGTCCTGACCTTCGACACCATCCGCCGGGTTCACG
CCGCCACCATCGAGCACGCGACGCAGCGCCCCGACCGCCTGGCCCTGGAAGCGGCCAGGGCTCACGCGCC
CGATGAGCGGCGCGAGGCTGCGACGCTGCCCGAGCCGCGTCCGCTCCAAGCCACCGTCCGCGCGGCTCTG
CACGCCAGGCGCAGCAGCTTCGGACGGTTCTCCGCGCAGCGGACGATCGCTGCGGACCAGCTCTCCGCCG
TGCTCGCAGCCGCTGCCGCCGGTGCCGCGCTGGAATGCGACGTGACGAAGCCAGGAGGCGCCGAGCTGGT
CAAGCTCTACGCGTTCGTCTCCCACGTCGACCAGATCGCCCCGGCGAGTTACGAGTACGACCCGCAGGAA
GGTGCGCTGCGGATGGTCAAGCCGGGCGCGCCCGGCTCGTTCCTCCAGCGCAACTACTTCCTCGCCAACT
ACAACCTGGAACAGGCCGCGGCCGTCCTGGTCCCCTCGGTGCGCACGCACGCCGTGCTCGACGCGGTCGG
CGACCGCGGCATCCGGCTGGTGAACGCGCTGGTCGGGGCGGTGGCGCAGGCGGTGTACACCGCGAGCGCG
GCGGCCGGCATCGCCTGCGGCGTCGCCCTCGGCTTCGACACCATCTCCTACATCGAAGAACTCGATCTCC
ACCAGGCCGGCGAGATCCCCTTGCTGACCATGATGATCGGCGCCGAGCGGCCGCGGCCGGCGGACTTCCG
CCACGATTTCGGCCCGCTCGGCCCTGTCCCGGGGAGCGTGCGGTGA
 Primer design

Protein Sequence:551 a.a.
>Caci_3691|ThioFinder325 Catenulispora acidiphila DSM 44928
MGFAHEYATAVAWRGRVLMEPADFVPNWADKPRRAKYYPGALGFPLPDTEDEAAASVQKGLFDPAGSQPF
TLSLLGGMLRDSYGLIGRRLGVQANTDLAALPSYKDANWSRGTASGGGLYPIGVYWLSGPSGPLLPGAYH
YSPGHHAMQRLVVGDPTGEVRAAVGDEALTADTDQFLVLGIKFWQNAFKYNSFSYHAVTMDVGTVLQTWR
MWAGARGLRIDPLLWFDEQRLSRLLGVSTEDEGLFAVVPVRWDAPSAPTAEPATERLTEPPNERPTEPPI
QVRRTDQERSRTVLTFDTIRRVHAATIEHATQRPDRLALEAARAHAPDERREAATLPEPRPLQATVRAAL
HARRSSFGRFSAQRTIAADQLSAVLAAAAAGAALECDVTKPGGAELVKLYAFVSHVDQIAPASYEYDPQE
GALRMVKPGAPGSFLQRNYFLANYNLEQAAAVLVPSVRTHAVLDAVGDRGIRLVNALVGAVAQAVYTASA
AAGIACGVALGFDTISYIEELDLHQAGEIPLLTMMIGAERPRPADFRHDFGPLGPVPGSVR