Home 

Gene Symbol:  
Caci_3689
Organism:  
Catenulispora acidiphila DSM 44928
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4131051..4133312 [1], 2262 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003114432.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2262 bp
>Caci_3689|ThioFinder323 Catenulispora acidiphila DSM 44928
ATGGCGACCTTGCAGGAGCCGATCGAGGAAACCAGGCCTCGTATACGGCGTGACGTACTGTTCACCGAGT
CTCCCTCCGGCGTGTTGTTCCACAACGCCGACGGCGGCTTCTCGGTGAACGGCGCCTCCGCCTACCGCTT
CGCCACCCTCATCGTTCCGCACCTGGACGGCAGACGGCAGGTGGCGGAGCTGTGCGCGGGTCTCGGACCG
AAGCAGCGCGACATGGTCGTGGACCTCGTGCGCACCCTTTACGATCGGGGTTTCGCCCGCGACGTGCCGC
CGGAGGACGCCGACGCGGTGTCGGCGTCGGTGCCGGCCGCGGTCGCTGAGCGCTTCGCGCCCCAGATCGA
CTACATCGACCACTACGTCGGCTCGGCCACGGAACGGTTCCACCGCTTCCGCGACGCGCGGATCGCCGTG
CTCGGTACCGACCCCGTGGCCCGCTGGTGCGTGCTGAGCCTCATCCGCAACGGCGCCGCCTCGGTCGCCG
TCCAGCCCGGGATGCTCGCCGCTGAGGGATTCGCTCAGATCTCGGCCGAGGCCGAGGAACTCCGAAGAGC
GGACTGTCCCACTGAGATCACCGAGCTCACCGAGACCACCGAGCTCACCGCCGACGGCGAGCTGAGCTGG
GCTCACCTCGCATCTCACGACCTGGTGCTGCTGGCCGGTCCGGACGCGGTCCAGCGCGCGCTGCCGTTGG
TGCGAGCCGGCATCCCGGAGGGCGTCAAGCTGCTGACGGCGTGGTCCTTCGCGGACCTGGCCGTCATCGG
CCCGCTGATGACCGGTGGCAGCACCGGCTGCCTGATCTGCGCGGCGCTGCGCCTCGGCGCGAACGGCGAC
CCGGCCGCCGCGGCGGATCTCTGGAGTTCGGTGGCTGTGCCCGGTTCGGCGCCGGCGCCGCGGACCCTGA
CCGGTCCGCTGGCCGGCATGGTCGGCAACCTGCTGGCCTACGAGGTCTTCCGGGTGACGACCGGCGCGCT
GCCCGCCGAGACCGCCGGGAAACTCGTCATTCAGGACCTTGATTCCCTCGACGCGTGGTCCGAGCCGCTC
TTCCCGCATCCGCGCTGTCCCCGGTGCGTCCCGGACGCCGCTGCCGAACCCGATCGGCAGCAGCTGTGGC
CGCCGGCCGAGGCCGTCGGGCAACCGGCCGCGCAGACCGCCGTCGAACTCGAGGATCCCGCCGAGGTGCT
CGACCACCTGACGTCCACGGCGGTGCTCGTCCAGCAGCGGGCCGGCGTCTTCCAGGCGTTCGCGGACGAG
GCGTGGAACCAGACCCCGATCAAGATCGGCACCGTCCGCCTGGGTCTGGGCCGCGGCGGTCTGCGCACCG
TGACCGCGTTCGACCTGCACCACGTCGCCGGAGCCCGGATCCGCGCGCTGCACGCCGCAGCCCGCGTCTA
CGCCGACCACGTCGTTCCGGTCGGCGGGCTGGTATCCGCCGCCGCGCTCGATCAGGACGGATATAGCAGA
TGCCGGGTCGAGCCCGCACGCTTGGCAGTGGCCGGCGGCACCGCCGCCAAAGCCGAAGACGTGGCGCATT
GGGCGCAGGCCTATCGGCTTGAAGCAGGCCACAGCGTCCTCGTGCCCGCAGCGGCGCTGCGGACGTTCGG
CGCTGAGAACAGTTCGCTGATGTGCCTGCCGACCTCCGCGGGCACCGGCACGGGCGCTTCGCCGGCCGAC
GCGGTCGCCGACGGACTGCTCTCCGCGCTCGCCCTGGACGCGCTGATCGGCGCGGTCCGCGGCAGGGTCC
CGGTGCGGTCGGTCGATCTGAAACTGCTGGAGGCCGACGCCGAATTGCTGTTCCTGGCCAAGTCGGCGCG
CAATCTCGGCGTCGAGGTGGAACTGCTCGGTCTCGGCGATCGCGGCACGCGGCCCGCGCCGGTCCTTCTC
GCCCGGACGCGGGGCGCGCACGACGGCGAGCCCCGCTGGGCCGTCGGCTGCGCGACCCGCTGGCAGGAAG
CCGCGGTCTCCGCGCTGCGCGACCTTCTCGGGGCGGTCCAACTGGACCGTCAGCTCGGCGACGGCGCCCA
TGCGGACCTCGGCGATCCGCTGATCGCCGACCTGGACCCGGCGGCGTTGTCCGTCGGCGGCTACGCGGAT
CCGGTGTTCACCGCCGCGACCGGATGGGGCGAGGTGCTGCGGCGCACGCGCGCCGCCGGGAACGACATCC
TGGTCGCGCCGGTCGAACTCCCCGATCTCGCGGCGGGCGGGATCTGGGTGGCGAAGGTGCTGCTCGTGCG
GGAGAACACCGATGCCCGCTGA
 Primer design

Protein Sequence:753 a.a.
>Caci_3689|ThioFinder323 Catenulispora acidiphila DSM 44928
MATLQEPIEETRPRIRRDVLFTESPSGVLFHNADGGFSVNGASAYRFATLIVPHLDGRRQVAELCAGLGP
KQRDMVVDLVRTLYDRGFARDVPPEDADAVSASVPAAVAERFAPQIDYIDHYVGSATERFHRFRDARIAV
LGTDPVARWCVLSLIRNGAASVAVQPGMLAAEGFAQISAEAEELRRADCPTEITELTETTELTADGELSW
AHLASHDLVLLAGPDAVQRALPLVRAGIPEGVKLLTAWSFADLAVIGPLMTGGSTGCLICAALRLGANGD
PAAAADLWSSVAVPGSAPAPRTLTGPLAGMVGNLLAYEVFRVTTGALPAETAGKLVIQDLDSLDAWSEPL
FPHPRCPRCVPDAAAEPDRQQLWPPAEAVGQPAAQTAVELEDPAEVLDHLTSTAVLVQQRAGVFQAFADE
AWNQTPIKIGTVRLGLGRGGLRTVTAFDLHHVAGARIRALHAAARVYADHVVPVGGLVSAAALDQDGYSR
CRVEPARLAVAGGTAAKAEDVAHWAQAYRLEAGHSVLVPAAALRTFGAENSSLMCLPTSAGTGTGASPAD
AVADGLLSALALDALIGAVRGRVPVRSVDLKLLEADAELLFLAKSARNLGVEVELLGLGDRGTRPAPVLL
ARTRGAHDGEPRWAVGCATRWQEAAVSALRDLLGAVQLDRQLGDGAHADLGDPLIADLDPAALSVGGYAD
PVFTAATGWGEVLRRTRAAGNDILVAPVELPDLAAGGIWVAKVLLVRENTDAR