Home 

Gene Symbol:  
cpfrc_01626
Organism:  
Corynebacterium pseudotuberculosis FRC41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1774428..1777031 [1], 2604 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003784026.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2604 bp
>cpfrc_01626|ThioFinder551 Corynebacterium pseudotuberculosis FRC41
ATGACAAACATTTCTTGGAAGCTCCTCGACGAAGGTCTCGTTCGTAGCTGCAGCTTGCCGTACACGGCAT
TGCTCCAGCTTTATGACGTCCCCACCAATGCATTACTTACTGCGGATCTAGCCCGACGGCGCCAGTTAAA
AGCAGCCTTCAAGTCCCTTGAAGCTACGGCGTGTCGGGAAGTCGCAGGATGCGTAGACGCAGTAGTGCGC
CATAAGCTACTTGATCTTAAGCGAGCCGCACATCAACATGATGCGACAAAAATTCACACAGTACTGACCA
AAATAAAAGCCGCGGGAATATCGTTGCCTGCTGCGGTACTGACTGCTGCCAATGCCGCAATCGCCGCTGC
AGAGAATGTGCTGTCTCCAGAGGTACTGCGCGAATTGCTTCTGCATTCCACTAAACAAGAACGCGCGCTT
CTGGGAAAAATCGTTAGAGAACAGGGAATCGATTCGGCAGTATCGGTTACGTCAGTCTCAGCAGCCAAAG
CCATCCGGAATCTAGGCATAGACCATAGGATGTCTGCTAAGCAGCTGGCTCGCGCGCATCGCACCGCGCT
AGGCTATGTGATCCGTAGCGCCACCCGGACAGTTCCTTTTTCTACTCTCTGTACAATTGCGCCTTTTCAG
TTTTCCCCTGCCAGCGCTCACCTGAGCGATCCCCACATCCCCGCCGCCACGCAGGCTATTGCCCAATGGA
ATGTGTACGCCATGTCTCAGATTTTTTCTGCGATAAAACAGGACTTTGAGCTCATCGCCACACTCCCGAT
CCGGGTTAACCCTGACGCGTTATCTGAAGATGCACACTGTGTGCTGCCACGGTGCTCTGTTGAATATTTA
GGACACGTCGGTGATCGAGACCTTGCTGTTTATCGGGAAGAGCGCCGGGTGGTGGATTCCCAGGGATTAT
TTGGAAAAGTTATGGCTTTGGCTGCAAGCGCTGCGGACAGCGGCGAATACACCTGCGGTCAGCTGGCAGC
AGAGCTTTCCGGTTGCACAGGGTTAAGTGCCTCCCAAGCGCAGTGCATTGTGCTGGATGCCATCCGCATT
TCGGCTTTAGTTGTTCCCGACCTAGATTTGTCTCCGTCCACAGCGGTTAGCCCTCAGCCGATAGTCGGGC
ACCTTGCACAAGGAACGGAAAAAGCCGTATCTGTCGCTCGGATTATTTCCCACATAGCAGCAGGATGCAA
AGTGGTGGCGTCGATACGCGCCTTTGAGCTCAAACATGCTCAGGTTCTAAAACTCACACGCCTTTTAGAA
AGTCTCAGGCAACTCGTCAACCCTGGCATCCCCGTGTTCCATACGTCTGTCTATGAAGATGGAGTGGGGA
AAGCATCAACGGTTTCTGCCCACGTAACAGAGTCTTGCAACGCTCTTGATTGGAGTACTCTCGCGCACCT
TGTGGATCTGCTTGATGTTAGGCAGGTAGAACGCTCCTTGTTTGAAAAGTTTGTGTCTGACAAATTTCCC
CGTGGGGAGATCTGCCACAACGTGCCGGCGGTGGTAAATGGTTTTGTTTCTGAGGTTCTCACGCCTCTGA
GACAAATTGACATTGAGGCAGTGAATGAAAACGATCTGAAATCCACTGCGGCTTTACCTCTAGGTAAGGC
TTGGAAATGGATCCGTGCTCGGCGTCATTTCCTAGCTCGCATAGCCGCGGTGAGAAGTAATGCCGCTGGC
CCCGTGGATGTACGTGCTCTTCTCAATGATTATCTTCCGCTCATGAGGTCTCGTACGTATCCATTTCGGT
CTTTGAACGCCTACGTTCAGCAAGACGCTGAGGGAGAACTCGTGATCAACCGTACGCTCGGGGGACCAGG
TTTTCCGTGGTCACGGTTTGCACACGCAATACCGGATTCCGCAGCTCATGCATGGTCCGAATTAGCAGAT
AGATCGTCTAACGCTGGAGTTCAGCTCGTAGAGCTAACGGCTGGCAAAGTAGTCTCCAACCTCAATGCCC
ATCCAGATACCTACCAGGCCTCCCTGATCATTCCAGGACATCCTAGGGAGTCCATAAAAACAAATGATAT
TCGTCTTGCAGACACCCAATTGACATATTGCGGGGCCAAAGGACGCTTACAGCTTTTCGACGCCCAAGGC
ACTGAGTTATTCCCCGCTTACATGGGGTACATCACCGACCGAGGCCTGCCATTATCTACACAAACTCTCA
TGCTCCTAGCGCCTCCCGCACATTGTTCCCTGGACTTTTTTCCTCCTCCAACTTCAGAGGTGGTGCGTCA
GGCTCGCCTCCTTCTGGGAGACGTTGTCATAGCAAGGGAAAGCTGGATCTTTCCTGTTTTATCCGCATCT
ATGAATATCCCTGACAGCCTAGAAGAGTCCCTAGTGTGGTGGCGCACTATGTCCCAGCATCATGAGCTCC
CCTCCTGCGGGGTACTGCGGACTTTTGATATCCGAGGAGGGGTGAATAAAGGGCAGTTTTATGATGCCCA
GATCATGGGGACAATCCTTAACCTCATACGAACACTGCGCAACGCTCACTACGGGTTTGTCATTGAAGAA
TTCTTTCCCCGCATTAGTTCATCCGACGTAGCACAGGAATACATAGTCACAGGAACACACGACTCTTTGA
AGGAGGGCATCTGA
 Primer design

Protein Sequence:867 a.a.
>Cpfrc_01626|ThioFinder551 Corynebacterium pseudotuberculosis FRC41
MTNISWKLLDEGLVRSCSLPYTALLQLYDVPTNALLTADLARRRQLKAAFKSLEATACREVAGCVDAVVR
HKLLDLKRAAHQHDATKIHTVLTKIKAAGISLPAAVLTAANAAIAAAENVLSPEVLRELLLHSTKQERAL
LGKIVREQGIDSAVSVTSVSAAKAIRNLGIDHRMSAKQLARAHRTALGYVIRSATRTVPFSTLCTIAPFQ
FSPASAHLSDPHIPAATQAIAQWNVYAMSQIFSAIKQDFELIATLPIRVNPDALSEDAHCVLPRCSVEYL
GHVGDRDLAVYREERRVVDSQGLFGKVMALAASAADSGEYTCGQLAAELSGCTGLSASQAQCIVLDAIRI
SALVVPDLDLSPSTAVSPQPIVGHLAQGTEKAVSVARIISHIAAGCKVVASIRAFELKHAQVLKLTRLLE
SLRQLVNPGIPVFHTSVYEDGVGKASTVSAHVTESCNALDWSTLAHLVDLLDVRQVERSLFEKFVSDKFP
RGEICHNVPAVVNGFVSEVLTPLRQIDIEAVNENDLKSTAALPLGKAWKWIRARRHFLARIAAVRSNAAG
PVDVRALLNDYLPLMRSRTYPFRSLNAYVQQDAEGELVINRTLGGPGFPWSRFAHAIPDSAAHAWSELAD
RSSNAGVQLVELTAGKVVSNLNAHPDTYQASLIIPGHPRESIKTNDIRLADTQLTYCGAKGRLQLFDAQG
TELFPAYMGYITDRGLPLSTQTLMLLAPPAHCSLDFFPPPTSEVVRQARLLLGDVVIARESWIFPVLSAS
MNIPDSLEESLVWWRTMSQHHELPSCGVLRTFDIRGGVNKGQFYDAQIMGTILNLIRTLRNAHYGFVIEE
FFPRISSSDVAQEYIVTGTHDSLKEGI