Home 

Gene Symbol:  
cpfrc_01624
Organism:  
Corynebacterium pseudotuberculosis FRC41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1771388..1772926 [1], 1539 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003784024.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1539 bp
>cpfrc_01624|ThioFinder549 Corynebacterium pseudotuberculosis FRC41
ATGACTCCGCGCGTCGCATATCTACACTGCCCGGCGCGCATCCTGCCCCCGCGACATGAGCAGTGGGTAG
CGATCCCCCCTGACGTATGCAGGAGCTGTTTTACCGAGTGGGTAAGCCGCACTGAAGATGCTGCACACTG
GGTTAACGAGTCTAAGGTTCCGGCCTTTATCAGACGGTGGTTATCTGAGTGCTTGCAATATCGCGGGCAT
CCCCGAGGAGGCTGGAGGGTCGCAGCTACTGATGCTCAGTGCCTTGGCAGCTCCACGGTGTTTATTCCGC
CAAACCCATGCTGCGCTAAGCACCACACCTGGGTTGATAGCGCAAACCTTTCTGATCTCACAGGGCCGGT
GCTGGCACCATGCGGGGTGGGACCTAATACCGCGGTTCAGCGCCCTGGAATAGTTGTTTCTCGTGGTACT
GTGCCGGCCTTAGGCCCTCGACCGGCCTTCCACTGGAGTGGTCAGGCACCAACTATTTCTGAGAGCCGAA
AGCTGGCTCTCTTTGAGGCTGTCGAGCGAGCATCAGCATGCCAAAGAACTGGGAAGCCAAGAGACTTCGG
CACTCGTGTTCCGCGTGTTCCTGCGGCTGACTTTGGAGTAGAAAATACCCGGTGGAACCGTTCTTATGGT
CGCTGTAAAGATTGGACAGAGGCAACTCGTCTGGGAGACGCAACTGAGTGGTCAATTCCCACAGACATGG
TGTTTTTCTGGTCTGACTCAAAAACTCGTTTTTGCTTTGATTCCTCCAACGGGGCTGCGGTAGGACCCAC
TTGGGAGGACGCGGTTATGTCCGGGTTATTGGAGGTTATTGAACGTGACGCGGTTCTAGCTGTATGGCAC
GGTTCTATGTCCGTTCCAGAGATTGACATTGGATCTATCAACGATCGTACTTATCGGGCAATGCTGCGGA
ATCTTCACAGACAAGGGCTGGCTATCCGCGCGTTTTATTGTCCGCTCAGCGTGGGAGTTCCCAGCGTTAT
TGCAGTGTGTACTGACGCCGCACGCACTTTCCTTTGCGTAGGGGCAGCGGCTGCGCCCGACCCGAATGTC
GCACTGCGCAAAGCGCTGAGGGAGGTCATGGCGGATTATCCGCAGTCGCGTTTGCTAGCTGCTACGCAGA
TAACGGATGCCGCCGCAGCGCGTGCGGATGGTTCCGGGGCAGCTCACCGTTTAAGCGTGACTGCCTCCGA
GCTCATCCATGCCGCCGCTTTCTTACTGCTTCCTCGAAAAGAACTAGTCCGGGTCTCCGATATCCCGGGA
CAACCACAGTTGTCTCTCAAAGAGTTAGTCGGATGTCTCAATGCTCATGGATTCCATGGCTATGTTGTTG
ATCTCACCGAGAGCTACCACCAAATGGTGGGGCTCACAGCTGTCAAGGTCATTGTTCCGGGTCTTCTGCC
GCTGGAATATATCGGACAACTTACTCGGGCTTTGCATATGCCGCGATTGAAACAACAGATGACATGTTTT
CGTGCTTTGGGTCTAACCTCTTCCAGCGCGAATCCCCGCCTCAATGTAGTTCCGCATCCGCTCCCCTAA
 Primer design

Protein Sequence:512 a.a.
>Cpfrc_01624|ThioFinder549 Corynebacterium pseudotuberculosis FRC41
MTPRVAYLHCPARILPPRHEQWVAIPPDVCRSCFTEWVSRTEDAAHWVNESKVPAFIRRWLSECLQYRGH
PRGGWRVAATDAQCLGSSTVFIPPNPCCAKHHTWVDSANLSDLTGPVLAPCGVGPNTAVQRPGIVVSRGT
VPALGPRPAFHWSGQAPTISESRKLALFEAVERASACQRTGKPRDFGTRVPRVPAADFGVENTRWNRSYG
RCKDWTEATRLGDATEWSIPTDMVFFWSDSKTRFCFDSSNGAAVGPTWEDAVMSGLLEVIERDAVLAVWH
GSMSVPEIDIGSINDRTYRAMLRNLHRQGLAIRAFYCPLSVGVPSVIAVCTDAARTFLCVGAAAAPDPNV
ALRKALREVMADYPQSRLLAATQITDAAAARADGSGAAHRLSVTASELIHAAAFLLLPRKELVRVSDIPG
QPQLSLKELVGCLNAHGFHGYVVDLTESYHQMVGLTAVKVIVPGLLPLEYIGQLTRALHMPRLKQQMTCF
RALGLTSSSANPRLNVVPHPLP