Home 

Gene Symbol:  
Bsph_4011
Organism:  
Lysinibacillus sphaericus C3-41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3885398..3886231 [-1], 834 bp
Product Function:  
lantibiotic biosynthesis protein
Product Locus:  
 YP_001699609.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:834 bp
>Bsph_4011|ThioFinder573 Lysinibacillus sphaericus C3-41
ATGTGGATATCTAAACATTTATTCATTCATGATTATGTGTTAATTGAAGAGTTTTTAAAAGAGTATTTGT
TGCCATTTTTAGAAAGAGAAAAGGTTCGATATTTTTTCATTCGTTATTGGGATGGTGGTCCCCACATCCG
TTTGAGATACCAAACTGCACAAGATATAGCAGAGAAAGTTGATAAAGATTTGGAGCAAATATTAGAGAGC
TTTCACCAAAAACATAAGAGCCATTCATTTCAAGCTATTTCCTATGATGAGGCGATTGTTCAGACAGAAG
GTATTGTACCAACTGCTCCATATCCGAATTTTTCAATTCAGACGATTGAGTATGTACCAGAGCTAAACCG
TTATGGGGGAGAGACAGCAATGGCGCTATCCGAAGAACTATTTGTCCACTCGTCAAAATTTGCTGGACAA
ATAATTCAAAACCTTAATCGAACTCAGCGTTATGTGTTAGCGATTGATCTCATGTACAACTGTACAAAAA
TTGCTCAAGAATTAGGGTATATCGAGAAGCATGAGACAATGTTTCATGCATATCGTGAAATATGGACGCA
ATTTTCTCAGAATAAGGCCCCGGAGCATATATTCAAAGTGATTAACAACAGAATCGATCAATTGAAAAAT
GGCGAGCTTGCAATTGAATTCTATCAACCATATCTTAAGGTGTTCAAATCTTTGCTTGCTCAAATAAAGT
TATGTCAAACAACAATGGAGCCAAAGTACGCCTTTTATATTGTCATTTCTCATCTCCATATGTTGAATAA
TCGATTAGGAGTATCTCCGGAATATGAATTCATTTTTTCAGATGCTTTTCTTAAAGCTGGATGA
 Primer design

Protein Sequence:277 a.a.
>Bsph_4011|ThioFinder573 Lysinibacillus sphaericus C3-41
MWISKHLFIHDYVLIEEFLKEYLLPFLEREKVRYFFIRYWDGGPHIRLRYQTAQDIAEKVDKDLEQILES
FHQKHKSHSFQAISYDEAIVQTEGIVPTAPYPNFSIQTIEYVPELNRYGGETAMALSEELFVHSSKFAGQ
IIQNLNRTQRYVLAIDLMYNCTKIAQELGYIEKHETMFHAYREIWTQFSQNKAPEHIFKVINNRIDQLKN
GELAIEFYQPYLKVFKSLLAQIKLCQTTMEPKYAFYIVISHLHMLNNRLGVSPEYEFIFSDAFLKAG