Home 

Gene Symbol:  
Bsph_4017
Organism:  
Lysinibacillus sphaericus C3-41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3892023..3894425 [-1], 2403 bp
Product Function:  
lanthionine biosynthesis protein
Product Locus:  
 YP_001699615.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2403 bp
>Bsph_4017|ThioFinder579 Lysinibacillus sphaericus C3-41
ATGCGAGAAAAAGCGAAGGAAATTCAGTCTGCTAAAGACGAGATTGACAATGTTCATGAACAAATTGAAA
GAGAGAAAGAAATTGTAGTCAGTCAAATTGAAGAAGAGTTCTCTCTACAAAAGGATCCTAAGCTATTGAA
TCTGAAACGGGATGTTCATAATTTACGTAGCATTCGTTTAAGAAAATACTCAGGGCCAATTTTGTTGAAG
CAACTAGTAGACCTTTTAGATCAATTAGAGTTGTACCAAGAAGCACTGCATCGACGTTATGAGGAAGCCG
TATTGAAATCGAGGGAGATTCTTCAAAGAGAAATAGCGGATGAACAACTGCAAAAGACCGTTTTATTTTT
TAATCAAACTATTTATAAGAACATTGAAAAGTATTTATCCAAACCGGTACAAACACATAATAAAAAAGAA
AAAAAGTTGGACAATTTTATTATCAACTTATTAATGCGCAGCTCTATGAAAACTAGTCCGTTTTCTTACC
TTACCCAAACGGGCTCTTCTGGTAATCGATTTTTAATAAAAAAGAAGGCAAACATCGAATTAAATCATGC
TCTACTTTTTAGAATATTTTTGGAAGCTATTCGTACCGACGAGGAATCATTAGAAAAAATCCCTGTCCAT
GTTTCTAAATTTGGGCAAAGGAATTCTAAGATTTTCTTTGTCACGCAAGAGAATGTTCCACAATCTAAGA
AAATATATGAAACAAGAGATAAGCTGGTTGAAATGGGGATTGCGGAAGAAGTAATTCAATTTCTAAAGAA
AAAACAAGGGCAAACTATATTTTATAAAGAATTTGCTCAATTTCTAAGGGAAAAAGAACTTTATTCGGGG
CATGAGTTGGATGTATTTAAAAAACTTGTTTCCACAAAAATAGTAGTACAAAAAATTTCAGTAAATGCTA
AAAGAAATCTTGTAAAAGAAATGATTTCCTTTTTAAACGAACATGGTATTTGCGAAGAGCTATCACGCCA
GCTTCAATTAATGAATGAAATGCAAAAGGAGTTTGAGCAGGCAGATACAAATGAGCGGTTAGTTCTTTGG
AGAAAGATTGAGGATATGATTAAAAGTTTGAGTGAAACCATTCCGAATTTTGGTACGGAAATTCTATATG
AAGATATCTTGTTTGATGCTCAGAGCAATAAGAGCAGTCTCAAAGATATTGAAAATAAGTTTTCTAATCG
TTTTTTTGAAGAAATTACGGCATTTTTACTGTTATTTGATGTGAATATTCGTGTGCAATACGAAGTGGCA
GCGCTATATAAAAAATTATATGGCCATTCGGAAATCAGTTTGTCTGACAGCAATTTATTAAACAATGTAT
TCTTCGAAAAATTGAGATACTTCTTCCCTTATTTCCAGGACATGGATTACCGATATGATGAAGCGATTGC
ACCTGAAGTAAAGATTTTGGATGATCTTAGAGATGAATTTAAGGCATTCTTTTCTCAATACTTAGATGAA
AATCAAGCAGGAGAAATAGACTTTCAGGAACTAATACAGCCTTTTTCTAAAAAAATTCCTAAATATATTA
AATACGGCAATGAATTTAGTATGACCTTTTTTTATCAGCTTTTTCAGGAGAAAGTAATTTTAAACGATAT
TTATGATGGTCAGGAGAAATTTTTATCTAGATTTAAAGACTTCTTCGAGGACTTAAATAGAGATACACAG
TATCAAGAATATATAGGGAAAAATTATTATGACAAAAATTATTACGAAGTAACAGAGCTGTTTGGATTTA
ATGGCGGCATTCATGATAGAAATTATAGTCAAAAATTAAATCTGGAATTTGGATATCAGAGATTCCATGA
TGTTGGGCATCCTCATATATCAGATTTTTCGGTTAAATATGATGAGAAAAAGAAAAAATTGATAGTGCTT
GACCATCAGAAGAATGAAGCGAGAGTAGCCTATAAATCATCATTAGTTCCAGTGTTTCTCCCGGGAGTTT
TATCTGTATTGCTACTTTTGTTTCAAAGCGGAAGAATCAACTTTGATATAAATTACTTTTTGAAAAAAAG
AAGTGATATGCCAAGAATTATTTTTGAAAATATTGTGATGTATAGAAAGAAGTGGACTATCAAACACGAA
GATTTAAAGTGTATCAGTAAAGAAGCCGCAGATGAAGTAGAGCTATATTCATGCATTAATAACTATTTTA
AAGATCGGCATTTACCTGAAACTTTCTTTTTAAAGAAATATCGTATGGGTGAAGAAATTTCTGCGATGAA
GCCATTGTTTATTGATATTACAGTACCAATACTATTCAAACATTTTATGAATGAAATTACCAATGAAGAA
AGTCAAGATCCTACGTTCTTTATCGAAGAGGTGTTACCTGAATTTAAGAATGACCTTAGGGAATATGTTG
TGGAATATACGATTGACAATTAG
 Primer design

Protein Sequence:800 a.a.
>Bsph_4017|ThioFinder579 Lysinibacillus sphaericus C3-41
MREKAKEIQSAKDEIDNVHEQIEREKEIVVSQIEEEFSLQKDPKLLNLKRDVHNLRSIRLRKYSGPILLK
QLVDLLDQLELYQEALHRRYEEAVLKSREILQREIADEQLQKTVLFFNQTIYKNIEKYLSKPVQTHNKKE
KKLDNFIINLLMRSSMKTSPFSYLTQTGSSGNRFLIKKKANIELNHALLFRIFLEAIRTDEESLEKIPVH
VSKFGQRNSKIFFVTQENVPQSKKIYETRDKLVEMGIAEEVIQFLKKKQGQTIFYKEFAQFLREKELYSG
HELDVFKKLVSTKIVVQKISVNAKRNLVKEMISFLNEHGICEELSRQLQLMNEMQKEFEQADTNERLVLW
RKIEDMIKSLSETIPNFGTEILYEDILFDAQSNKSSLKDIENKFSNRFFEEITAFLLLFDVNIRVQYEVA
ALYKKLYGHSEISLSDSNLLNNVFFEKLRYFFPYFQDMDYRYDEAIAPEVKILDDLRDEFKAFFSQYLDE
NQAGEIDFQELIQPFSKKIPKYIKYGNEFSMTFFYQLFQEKVILNDIYDGQEKFLSRFKDFFEDLNRDTQ
YQEYIGKNYYDKNYYEVTELFGFNGGIHDRNYSQKLNLEFGYQRFHDVGHPHISDFSVKYDEKKKKLIVL
DHQKNEARVAYKSSLVPVFLPGVLSVLLLLFQSGRINFDINYFLKKRSDMPRIIFENIVMYRKKWTIKHE
DLKCISKEAADEVELYSCINNYFKDRHLPETFFLKKYRMGEEISAMKPLFIDITVPILFKHFMNEITNEE
SQDPTFFIEEVLPEFKNDLREYVVEYTIDN