Home 

Gene Symbol:  
Bsph_4010
Organism:  
Lysinibacillus sphaericus C3-41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3884642..3885331 [-1], 690 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001699608.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:690 bp
>Bsph_4010|ThioFinder572 Lysinibacillus sphaericus C3-41
ATGGATTATCATATGATGTCAATCAATGAACCTGAATTTACCAATACTCAAGTATATGCTCATAGACCGA
GGGAATTACAGGCAAATGGACATTATCCGTTAATAGATTTAGAGTATACGATTGACGAAAATAATATATT
TGAAAAAATTTTAGGGACAAGATATACGGCAAGGGAACCATTCAAAGCGAATGTCAAAGTCAATAAAAAG
TTAATGGCGCAATTTACTCAATTGGCTATGATTGGTGGTGAAAAAGAAAATCGTACATACCCTTCTGGGG
GGGCACAGTACTATGTTAACATTTATTTTTTATTCAATGAGCAATTGGTTGACATGGATTTGATAGAGCA
GGGAAATATTATGCTACTGAATAGTGATACTCAAAAGCTATTAGTTAAACAGTACGTGTCGTGGGATGAA
ATTAGTAAAGCGTTTATCCAAAAGTATTTGGCTAATACCGCTCAGTTTGCTGTTGCTTTGAGCTGTGATA
TGTCTGGAATCTCTGGAAAGTATACAGATATCTCCTATAAGCTAGTTCAACAGGAGGCTGGACATATTGG
ACAAAATATCCAATTAGTAGCGAATTACCTTGGATTGGAAAGTGTTCCCCTGGGTGGTTTTTATGATATT
GAGCTATCAAAACTTTTGAGTGATCATCAAACATCCTTGTATGCATTTCTGATAGGATAG
 Primer design

Protein Sequence:229 a.a.
>Bsph_4010|ThioFinder572 Lysinibacillus sphaericus C3-41
MDYHMMSINEPEFTNTQVYAHRPRELQANGHYPLIDLEYTIDENNIFEKILGTRYTAREPFKANVKVNKK
LMAQFTQLAMIGGEKENRTYPSGGAQYYVNIYFLFNEQLVDMDLIEQGNIMLLNSDTQKLLVKQYVSWDE
ISKAFIQKYLANTAQFAVALSCDMSGISGKYTDISYKLVQQEAGHIGQNIQLVANYLGLESVPLGGFYDI
ELSKLLSDHQTSLYAFLIG