Home 

Gene Symbol:  
Bsph_4013
Organism:  
Lysinibacillus sphaericus C3-41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3887430..3889103 [-1], 1674 bp
Product Function:  
putative cytoplasmic protein
Product Locus:  
 YP_001699611.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1674 bp
>Bsph_4013|ThioFinder575 Lysinibacillus sphaericus C3-41
ATGACCATACTAACAAACGTTGCTACGATTATTACAAACCAAAAGTATATTTTTGTACATTCATCCAAGA
ATGATTCATTCTTTTGCCTAAACTGCTTTAAGGAGCGAACAAAAGAACTGAAAAGCTACCAACAATATTT
TGGTTGGCAAGAAGATGAGCCTAGCCACTTAGAAGCAGAAATAATTGCTACTCTCTTGCAAAAGCTTCAA
ACAAGTAATGAACCGTACCTCTATGAAATAAATCGAGATACATTGGAAATTCAAGCGAAAGCAACTTTCA
AGCGAGGAGATTGTCACTGTAATGAAGATACTGCTCCACATAAACTTCAGGAATTGGATACGATGTTCGA
CGCAAAGGATAATCGGCAATTGAGCTTTGAACAGGTAAGAGAGAAGATTGAAAGAAACAAAAAACTAATC
TATGCGCATCCATCGTCGATCGTGAATGCATTGGCTCGTTCTGGAGATTCTTATGGTACACCAATGGTTC
AGACAGAAGTATTGTACAAGGGGATTTCAATGCTTTCCTATGGTCGGACAGGGACGTATGAGAAGTCAAA
ATATATTTCTATTTTGGAATCGTTAGAGCGCTATGCTACAGCGTTTCCTTATAAAAAGCAAAAAAGGTCA
ATGCGAGAAAAGGATTCAGAAGTGATCGACCTAACGCTAAGTGAAGTAATGGCGCAATGCAATTATGGCA
ATCCAGAAAATTATTCAGAAGATCAGCCACTGAATTATGAGAAAGTTTGGGCATTGCATAGTGAAAAAGA
TGTTTTAATTCCCGAGCAGCTAATTTATTATAACTCTCATGTTGTTTCTGATGAAAAAAGATTTATTTAT
GAAAGTTCTAATGGCAGTGCTCTCGGTTCAACAGAAGCAGAAGCTAGCCTTCATGCGATGCTAGAACTGA
TAGAACGAGATGCCTTTTTAGCTACTTGGTATGGACAAATTCCACCTGTCAGAATTGATGAATCAAGCAT
TCATTCTAAAAAAATCCAAGCTTATTTGGAATCCCTAAAGCAAAAAAATATTCGTGTACATTTGTTTGAT
ATATCTATGGAAGTGAAAATTCCGACTATCTGGGTCCTATTAGAAAAAAAGGAGCCTAGGGAAAATGAAA
TGGCCTTTTACACAGCTGCGGCAGCTTCCTTTGATTTGGAAGAGTCAATAGAACGAGCATTAATTGAAGC
TACAACAGCGATTACTGTATTTACAAATGTATTTAATAACGAGGATTATCAGACAAGAAAGAGACAATTA
TTGATGAATCCTCAATCGGTTCACAAGTTGGAAGACCACTTGCTGCTTTACTCAAATAAGGAGATGAAGT
ATGCATTTTCGTTTGCATTAAATACAGAGATGGTGTCTTCCTATGAGCAATTGGAAACAGGATATACAGC
ATATCAAGGGAAATTTTCCGAGGTTGTTCGAACGCTTGAGAAGCAATTGGTCGATATTTCTGGTAAAGCG
TATCGGGCTACGATGGAAAACCCGAATTTATTTTCTGCAGGATTTGTTAATGTGAAATATGTAGTGCCTG
GCATGCTGACAATGACTTTTGGGCATCAAAATAGACGAGTTGTCAGTCAGCGAATTGAAAAGGCTATTCA
ATATAAGAAGAAAGGGAAGCTAGATAAAAACTGGATAGAGAAAACACCACATCCATTTCCATAA
 Primer design

Protein Sequence:557 a.a.
>Bsph_4013|ThioFinder575 Lysinibacillus sphaericus C3-41
MTILTNVATIITNQKYIFVHSSKNDSFFCLNCFKERTKELKSYQQYFGWQEDEPSHLEAEIIATLLQKLQ
TSNEPYLYEINRDTLEIQAKATFKRGDCHCNEDTAPHKLQELDTMFDAKDNRQLSFEQVREKIERNKKLI
YAHPSSIVNALARSGDSYGTPMVQTEVLYKGISMLSYGRTGTYEKSKYISILESLERYATAFPYKKQKRS
MREKDSEVIDLTLSEVMAQCNYGNPENYSEDQPLNYEKVWALHSEKDVLIPEQLIYYNSHVVSDEKRFIY
ESSNGSALGSTEAEASLHAMLELIERDAFLATWYGQIPPVRIDESSIHSKKIQAYLESLKQKNIRVHLFD
ISMEVKIPTIWVLLEKKEPRENEMAFYTAAAASFDLEESIERALIEATTAITVFTNVFNNEDYQTRKRQL
LMNPQSVHKLEDHLLLYSNKEMKYAFSFALNTEMVSSYEQLETGYTAYQGKFSEVVRTLEKQLVDISGKA
YRATMENPNLFSAGFVNVKYVVPGMLTMTFGHQNRRVVSQRIEKAIQYKKKGKLDKNWIEKTPHPFP