Home 

Gene Symbol:  
Bsph_4018
Organism:  
Lysinibacillus sphaericus C3-41
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
3894469..3895506 [-1], 1038 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001699616.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1038 bp
>Bsph_4018|ThioFinder580 Lysinibacillus sphaericus C3-41
ATGTATCAAACCTGTATTTATAACTATGACAGTTCATTAGAACAATCATTGCTATTACTTATTGATGATA
TGTGGAATACAAATCAATATTTTGTGTCAAAGGGGTGGGAGGGTGGACCTCATATTCAGTTAGTTACAAA
AAATAAAATATCGCAATCTGAATATAAAACTCTGAAAAAGAGAGTGCACCAGCTAATCGAAGAGAGACCA
TTGGATAAATCCTATATGGATCAAGTGAAGAAAAAATATGAACAAAGTTCCCTATTGATTTCTAATTTGG
AAAATAAGAAAAGTGAACGTGCAATTCGAGAACACGGAGAAATAGACATACATCCTTATTTTTTGGAATT
TCATAATGAACGATTAACTAATTTATATATGAACGAACGATTCAGACATTACCAATTGCTACTGGATACT
AGAAAATATATAGAAGCGCAGAATATTAGGCTAGATGAGCTGTTTCCACTTATTTTTTCAAGAATTTCAG
ATATCTATCATGAAAAAAATAATAATAAAGGTTACTTTTCATTTGTCTCGCATGTTCATGGCTTCTTTGA
GCTTTCTGCCAAGCAAGAGAAACCCTACAACGAAAATTTATTTGAGACACTTTATGTAGAAAGGCAATTA
GGTTTTGAAATTGCAGAGAAAGCACATTCTCAGCTAATTAATAGATGGTATAAATATTTTTCAGAGTTTT
ATGGATGTTGTTTAAGTCAGGTGGACGAATTATTAGACGATCATTATAAAGCTGAATTGGCTCGTACTAT
AGAGGAATTAGAAAAAAATTTTAAAAATGATTTTCATAGGAATTTTGTTGCCTATTCAAAGAAAAATAAC
TTTATGGAAAAACCTGAAGCAACGGCCTATAGATTTACAGTAAATCTGCTGTATTTACTATTACCTTACT
TTAATATAAGTGCCTTGAAGAAGCAAAAGTATATTTATATGGCTTACAGAGTAGTGGAAAGTAAAAAAGG
GATGACTTGGAGGGAGGAGTTAGGACTTGACTATAACAGTTACTCAAAATCCATTTAG
 Primer design

Protein Sequence:345 a.a.
>Bsph_4018|ThioFinder580 Lysinibacillus sphaericus C3-41
MYQTCIYNYDSSLEQSLLLLIDDMWNTNQYFVSKGWEGGPHIQLVTKNKISQSEYKTLKKRVHQLIEERP
LDKSYMDQVKKKYEQSSLLISNLENKKSERAIREHGEIDIHPYFLEFHNERLTNLYMNERFRHYQLLLDT
RKYIEAQNIRLDELFPLIFSRISDIYHEKNNNKGYFSFVSHVHGFFELSAKQEKPYNENLFETLYVERQL
GFEIAEKAHSQLINRWYKYFSEFYGCCLSQVDELLDDHYKAELARTIEELEKNFKNDFHRNFVAYSKKNN
FMEKPEATAYRFTVNLLYLLLPYFNISALKKQKYIYMAYRVVESKKGMTWREELGLDYNSYSKSI