Home 

Gene Symbol:  
Haur_0923
Organism:  
Herpetosiphon aurantiacus ATCC 23779
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1057140..1058138 [1], 999 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001543699.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:999 bp
>Haur_0923|ThioFinder603 Herpetosiphon aurantiacus ATCC 23779
ATGAGTTTGGCAGTGCTGAATGGCAAAATCTACTATAGCCCGCAGAATATCAGCGAGCCATATGATCCGA
GAGCTGATCGATTGATTGCTGAAGCATGGACTCCGCTGTTCGATCAATTGCACGAACAGATTGAGTTGAT
TACCTGGTTGCGCTTTGCTGAAGGCGGCTATCAGCTGCGTATCGCCTGTTTTGCTGATGAGCACGTTTTG
CGCGAGTTTGCGATTCCGCTGATTCGTGAGCGCTTTACGGCCTATTTTGCCCAAAATCCTGATTTGTGTG
GCGATGCCCAGCCACTTTCGGCCCAGGCTGCGATTCTCAACCGCAAATTGGGGCTGGATACCGATGTACA
GGCCTTGGCTCAGCCTGGCACAATTCAACTTGAAATCAGCCATGATCTCGCGATTGGGCGCGATCACGAT
TCGCTGGAAGATTTGCAACACTACTATGCGCTGCAAACCGTGATTGCGCGGGCGACGCTCGATGTCATTC
CGCATACAACTGATTTGGTGGCCCGCAAAATCTTCATTCGGATCTTTTTGGATGAACTGTTGCACGCTGG
ATTTTTGCAAAGCTACGAAATTAGCCAGCTGCTTGAGCGCTTGCGCCAAACCTGGGTTGATTATTTTGAA
TTTCCAGTTGAGTTTATTTTGCAATCGGATGCGTTGGTGGCCCAATCGCTCGAACGACATTGGCGGTTTC
ATCAACAGCCGTTGGCCCAACGCCTCAGTTTATTGCCTGAAGCGTTGCATGAAGTTGTGCAGAATGGGTT
GGCGGGTTTACAACGCTATGCAGGGCCAGTGATCAAGCGCAATCAACAACAAGAATTGGCTCGTTCGAGC
TACGCTGCGCTTTCATCGCTGTTTCATCTGACCCATAACCGCCTGAGCGTGAGTATCGCCGAAGAAGCGC
ATTTGTGTAGTTTGTTGCTCTCGTTGGAACGCCAGCGCCAACAACAACCTGATCAAACCCTACAACAACT
GCTGGTGAACCAATATTAA
 Primer design

Protein Sequence:332 a.a.
>Haur_0923|ThioFinder603 Herpetosiphon aurantiacus ATCC 23779
MSLAVLNGKIYYSPQNISEPYDPRADRLIAEAWTPLFDQLHEQIELITWLRFAEGGYQLRIACFADEHVL
REFAIPLIRERFTAYFAQNPDLCGDAQPLSAQAAILNRKLGLDTDVQALAQPGTIQLEISHDLAIGRDHD
SLEDLQHYYALQTVIARATLDVIPHTTDLVARKIFIRIFLDELLHAGFLQSYEISQLLERLRQTWVDYFE
FPVEFILQSDALVAQSLERHWRFHQQPLAQRLSLLPEALHEVVQNGLAGLQRYAGPVIKRNQQQELARSS
YAALSSLFHLTHNRLSVSIAEEAHLCSLLLSLERQRQQQPDQTLQQLLVNQY