Home 

Gene Symbol:  
Haur_0922
Organism:  
Herpetosiphon aurantiacus ATCC 23779
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1054456..1057143 [1], 2688 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_001543698.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2688 bp
>Haur_0922|ThioFinder602 Herpetosiphon aurantiacus ATCC 23779
ATGACTGATGTTTATCAATCAAGCATTGTGATCGCCGCTGATCAACCTGTCCAACCAACCTGGCAACCTG
CTTCGCCCGTCTTGGTACGCTTGGCTGGAACAAGCTACAACCATTTACATAACCTAAAGTTTGAGCGCAC
GATTGGTCTGTTTCAAGTGATTTTGCGCCAACAACGCTGGCTCGATAACCATACCCAGGCAATTGTTGAT
GTGCTCTACACATTAATTGGCACAACCCAGGGTTCGCTTAAAAGCAGCTTGGTGGCCCTAAAACGCGATA
TTTTCAATCGCCGTTTGCCCTTGCGCAGCGATGTCGCTAGCTTGCGCAATCTGGAGCATCCAAGCTTGCG
CGGGCAGGTGCTGCGGTTTCGCCGCACCTTGCAGCAATTGCAACGGGCTTGGCGCGAGGCTCGGTTGGTG
TTTGAACAAGAATTACAAGCCAAACGGCGTTTGTTGCAACAAAGCTATGCCCAGCCAGCCTTTCAAAAAG
CGGTGCAAGTGGCTAGCTCAACCTTGGCTAGCAGCTTGCCGCGCTATATCAACGCCGATCCCAGCCAGTT
GCGCAGCCGCGAACGCAAAACCGAAGTTGGAGCCTACCAATATCTGATGCGCATGGCCGGCAAAACCAGC
CCATTTAGCCATTTTGGCCCTTTGGTGCTCGGCTCGGCTGACCCAACATTGGCTCAACCGATTGTGATTG
AAGGCCAAATGCCCCAAGCGCGGGCAGTCAGCCAACTGCGGCGCTCGGTGGTTGGCGCAATTCGCAATGC
TTTGGTGCGCATTCCGGCAATCAAGGCTTATTTGCCCTTGCGCTTGAATCCGAGTAGTTTTGTTGATGGC
GAGAGTTTAGTTTTTTCGCGCTTGCGCCAACAACTTGATGACCCCAACCAATATTTTGCTTCATGGCAAC
GCCGTGGTAAACGTTCGCTCTTGCTCGATAGTGTGTTAGCAGTTTTTGCCAACCAACAGCAATTGAGCTA
CGCCGAATTGTTGGAGCTTTTGCAAACCCAACATCCTGAGCTAAGCTCTGCCAAACTTGCCCAAACGATC
AATCAATTGCTCACCAGCGGCCTGCTCTTTTACAATTTGGATTTGCCCTCAGATTATCGTGATCCAGTGC
TGGTGTTGATTGAGCAATTAGCCGATGTTCCCTCGGCTGAGGCTGGGCAAATTCGTGAATTATTACAACG
TTTGGCTGAATCGGCGCAAGCCTATGCCCAAGCCACGGTTGCTCAACGTTGGCAGCTTGAGCAAAGCATG
CGCCAAATCGTCGATCAGATCTTGGCCTTTGCGCCCGAATTGAAGCAAACCAGCAGCCAACTTGGTCCGC
TAATCGTTGAAGATGTAGTTTGGGATGACGTAGCGGTGCATTTGGGGCAGCCATTATTGGCAAGCTTGGC
TAGCGATTTGGCTCCAGTTTTGGAGTGTGGTTTTCAGCGCGACGGGCGTGGCCCAGCCCAAAGTTGGCTG
CTCGATATTTTCACCCATGCCTTTGGCGAAGGCGGCCAAACCGACACTATTCTAGGCTTTGCGCCTGAAT
ATAATCGGCTCTCGGCCAATTCTGGCGAGCTGCCAATGCCGCGCATTAACGCTATTCAACAACGTCAACG
CCGTTATGGCCAGTTTTTGCACCAAGCGCTTGATGCTGAGCGCGAAGCCCGAGAATGTGTGCTTGATCCC
CATGCATTTTGGCAACTTGCCGCCGATTTTGGTCAACATAATCACTATGGCTCAACCAGTATTCAATTTC
AGGTGGCCGCCAGTAGCCAAACAGCGCTTGAGCAAGGCGATTATTTGGTGGTGTTGAATTACACTTTGCC
GGGCTTTGGGCGCTTCTTGACGCGCTATTTGAGCTTATTGCCTGCGCCAAGCTGGCAAACCTATGTGCAA
TCGGCATGGCAACCATTGCATAACGACGCTCAAGCCGTGCCAGCCGAAATTGTTTCGGTGCTCGAACATA
ATGCCCAAGTTCATGTGCCATTTACGGCAAATGTGATTGTGCCGCCCGACGAGCCAAGCTATCGTTCGCA
AGCGATTCAGCATGGCGTTGGCGATTTGAGCCTTGCCCACGATCCGGTTGCTGATCAATTACGAGTTTAT
CACCGCCACGCTGATGGCAGCCAACAAGAGCTTTTGCCCTTGTATATGGGCTTTTTGCATATGGTTTCGC
TACCAATTTTGCAACGGGTGCTGGCCCAACTCAGCCCAAGCAGCTATCACATGGAGCAATTGCGACCGCG
TGAGCAAACCTTGGTTTCGCGCAAGCAACCAACCAATGCCATCAGCCATACGCCACGCTTACGCATTGGC
CGCTTGGTCTTGCAACGTGAAAGCTGGAATGTGCCAACTGCCGCGATTCCTAGCAGCGTCGCCAACGACG
AATTTATGAGCTTTTTCAATTGGTATAGCTGGGCGGAACAAGCAGGCCTGCCGAGCGAAGTGTTTGTACG
CATCCAACGGCCACTTAGCAGCAAACATCTCAATATGTGGACCAACCACAAACCACTGGCGCTCGATTTC
GAAAATTATTTCAGCATTCAGATGTTGCGCCATGTGATTGCTGATGATCAGGTTAGCTTGACGCTTGAAG
AAATGCTGCCCAGCCCGCAGCAGCAGTGGTTTGATCTTGATCAACAACCCTATGTGATTGAATTTCAGGT
TGAGTTTAATCGGGGAGGCAGCATATGA
 Primer design

Protein Sequence:895 a.a.
>Haur_0922|ThioFinder602 Herpetosiphon aurantiacus ATCC 23779
MTDVYQSSIVIAADQPVQPTWQPASPVLVRLAGTSYNHLHNLKFERTIGLFQVILRQQRWLDNHTQAIVD
VLYTLIGTTQGSLKSSLVALKRDIFNRRLPLRSDVASLRNLEHPSLRGQVLRFRRTLQQLQRAWREARLV
FEQELQAKRRLLQQSYAQPAFQKAVQVASSTLASSLPRYINADPSQLRSRERKTEVGAYQYLMRMAGKTS
PFSHFGPLVLGSADPTLAQPIVIEGQMPQARAVSQLRRSVVGAIRNALVRIPAIKAYLPLRLNPSSFVDG
ESLVFSRLRQQLDDPNQYFASWQRRGKRSLLLDSVLAVFANQQQLSYAELLELLQTQHPELSSAKLAQTI
NQLLTSGLLFYNLDLPSDYRDPVLVLIEQLADVPSAEAGQIRELLQRLAESAQAYAQATVAQRWQLEQSM
RQIVDQILAFAPELKQTSSQLGPLIVEDVVWDDVAVHLGQPLLASLASDLAPVLECGFQRDGRGPAQSWL
LDIFTHAFGEGGQTDTILGFAPEYNRLSANSGELPMPRINAIQQRQRRYGQFLHQALDAEREARECVLDP
HAFWQLAADFGQHNHYGSTSIQFQVAASSQTALEQGDYLVVLNYTLPGFGRFLTRYLSLLPAPSWQTYVQ
SAWQPLHNDAQAVPAEIVSVLEHNAQVHVPFTANVIVPPDEPSYRSQAIQHGVGDLSLAHDPVADQLRVY
HRHADGSQQELLPLYMGFLHMVSLPILQRVLAQLSPSSYHMEQLRPREQTLVSRKQPTNAISHTPRLRIG
RLVLQRESWNVPTAAIPSSVANDEFMSFFNWYSWAEQAGLPSEVFVRIQRPLSSKHLNMWTNHKPLALDF
ENYFSIQMLRHVIADDQVSLTLEEMLPSPQQQWFDLDQQPYVIEFQVEFNRGGSI