Home 

Gene Symbol:  
Haur_0918
Organism:  
Herpetosiphon aurantiacus ATCC 23779
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1049889..1050707 [1], 819 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001543694.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:819 bp
>Haur_0918|ThioFinder598 Herpetosiphon aurantiacus ATCC 23779
ATGGATCAACTTTATTCAACCCTTGTGGCAACCCATCAGCAATGGCTGTTTGCCCAAGGTTTACACGAAA
ATCGCTCAGCTCGCTTGCTTTTGGTGACCGATGCAGTGATGGCGCAGGCACTCTTGGCTCGCTTGGGGCA
ACTGCCCTTAGCCCAGGTGACCGTTGCCGCCTTATCCAGCGCCGATCATGGCCCAATTTCACAACAGATT
CGCGAATTGACCAGCACGTTTCCAATTCAGCTGCTAGCGCGACCCTTCGCTGCTGGTGGTTTGGGCTTGC
TGCTCAGTCGCTATCACGCCGCTGCATTAATCACCCAGCGGCCTTATCCGGTAGTAGCCGAAGCCCTGAA
TCAAGCCAGTTTACGGGCTGCCACGCCATGGACTGCGCTCAGTCTGTGGGGCGCACAAATTACCTTGGGG
CCGACGATTTTGCCCAATCACACCGCCTGTTATGCCTGCTATCAAGCGCGATTACGCTCGTGCGAAACCC
GCAATGATGTCTGGCAGGCGCGTGATGGCTTTTTGCGGCGGCAACAACAAGCGTTATTTCAGCCCTCGCT
GGCGGCGCTCAATCAATTGGCTGCTAGCTATGGCTTGGTCGAAATCGAGCGCTTATTGCTTGGCCAACAA
CCACCGTTGGCGCTGGGCCGCGAAGTTCAATGGGATACATTCAATCTTGGCGTGAGCCGCAATCATGTTG
AGCCATTTGAAAACTGTTCAGCCTGTGGTGGTCAGCAAAATACTACTTGGATTGGCCGTGATCAATTAGC
TCAGGTGGTGGCCAAATTAAGCTTGCAAGCCCGCGAGGTGGCACTATGA
 Primer design

Protein Sequence:272 a.a.
>Haur_0918|ThioFinder598 Herpetosiphon aurantiacus ATCC 23779
MDQLYSTLVATHQQWLFAQGLHENRSARLLLVTDAVMAQALLARLGQLPLAQVTVAALSSADHGPISQQI
RELTSTFPIQLLARPFAAGGLGLLLSRYHAAALITQRPYPVVAEALNQASLRAATPWTALSLWGAQITLG
PTILPNHTACYACYQARLRSCETRNDVWQARDGFLRRQQQALFQPSLAALNQLAASYGLVEIERLLLGQQ
PPLALGREVQWDTFNLGVSRNHVEPFENCSACGGQQNTTWIGRDQLAQVVAKLSLQAREVAL