Home 

Gene Symbol:  
Haur_0919
Organism:  
Herpetosiphon aurantiacus ATCC 23779
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
1050704..1052536 [1], 1833 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001543695.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1833 bp
>Haur_0919|ThioFinder599 Herpetosiphon aurantiacus ATCC 23779
ATGACCCAGGCAATTGATTTACACAGCCAACTCCAGAGCGATCCGCAGGTGCAACTTCCAACTCGCCCAC
GGATCTCCGATGAAATTGCCCGAGTTTGGCATAACGAACAGCTGTTGTTGTTGCTGGGCGGGCCGCAAGA
TGTGGTGTTGCGTGGCAAAGCGGTGCGCAATCTGCTGCCGCAACTCTTGCCCTTGCTGAATGGCCTCAAC
ACCCGCGAAACGATTGGCGAACGCTTGGCCCAATTCAAGCCCACAACGATTGACGATAGCTTGCAGTTGT
TGCATGTGCAGGGGGTGCTTGAAGAAGGCCCATTGCCGAGCAATACACTTGATCCGCAAGTTGCCCGTGC
GTTCAGTCAACAACTAGCTTTTTACAGCCGCTTTGTTGACCAAACGCGGGTCTGTCGCAATCGTTATGAA
GTGCTGCAACGCTTGCAAACAACGCCTTTGTTGTTGATTGGTGGCGAACGCTTGGTTGCTCCATTGCTGC
ATCAATTGGCGCAAGCTGGCTTAGGCCGCGCCACTTGGCTGGCCAATTCAGCTCCAACCACAACCTATGC
CCTGCCACATTTGGCGCTTGATCTTCAAGTTCCGCAGGCTGATCAATTACCTGCAGCAGTTGATCATTGG
TTAGCTGAGCATCACGATGGCTTGATCTGTCTGCTGACCAGCACGGCGCAGGCCGAATTAACCCAAGCGC
TCAATCAACGGGCAATTCAAGCGCAAACTCGCTTTACCCGACTTTGGCTGCACCCACAGCATATTGAACT
TGGCCCAACCACCTTTGCTGGTGAAGCTGGCTGTTATGCCTGTGCCGAGCAAGTTGATAGCCACGAACCT
CAATTAAGCGAGCCAACCGCGCCGCTGAGCCTCAACGAGCAGTTAGCCTTGAGCCAAGCAAGTTTAGTGG
TTGGCAACCTAATTTCGGGTTTGAGTCCGGTGATTACGGGCGGCGTGCGTTATGTGCTTGATCCAACGAC
GCTTGAATTTGTGGCGCAATCGGTGCATCGTTTGGTGTTGTGCCCAGTTTGCGGCCAGCCCAACCTCGAT
GCGCCCCGCGATCTGTTGGTGGGCGCGGGCCATTTCGAGAATTTGCCGCTGTGGTATCACGCCAACACCG
ATGAGCGCAGTTACGCGATTTTCCCCAAGGCGCATCAGCAGCATTATGCGCCAAAAAATGCGATTGCAAT
CGTCAGTGGAGCCAAGGGTTATACCAATAGCCAACGCTATGCCCTGGGCGAATTGCAAGGCCAATGGCAG
CCTGATTCAACTGTTGATCTGAGCGTTCAACTGCCAGTTCAAACCTCGATTGCGCCCTTGGCTTGGCTGT
TTGAGCAAGCATTTGTGCGCAAGCCAGCCACCCAGGTGATCGCCGCTGGCCAACGTTTTGTACCTTCGGG
CGGCAATCTAGCCTCGCAAACGGTCTATTTGCTCAATCACAAGCTGAGCAATTTGGCGGCTGGCATCTAT
CACTTGAACCAACATGACGCTTCGTTGGAAGCAATGCGCCCACAGTTTAGCTGGGATGACGTTGCCAAAG
CCTTCCCCAGTGATCCGCTGAATCAACAAACCTTGGGTTTGATTGTGCTGACGGCGGCGATTGGGCGGGT
TGAAGGCAAATATGGCGCAAAATCGTATCGGATCGCGCTCTACGATTGTGGCGTTGCCGCGCAGGCAATT
GAATTTTTGGCAGCTGCGGCAGGCTGGCAAATCGAGCAAATCAGCGCCTTCTACGATCAAGAGCTGCGCG
ATCTGCTCCAGGTCTATAGCCCAAGCGAAACCCCGTTGCTGGTGCTGCGGCTGGTTGCGCCCAATCCTGA
GGTGCTGCAATGA
 Primer design

Protein Sequence:610 a.a.
>Haur_0919|ThioFinder599 Herpetosiphon aurantiacus ATCC 23779
MTQAIDLHSQLQSDPQVQLPTRPRISDEIARVWHNEQLLLLLGGPQDVVLRGKAVRNLLPQLLPLLNGLN
TRETIGERLAQFKPTTIDDSLQLLHVQGVLEEGPLPSNTLDPQVARAFSQQLAFYSRFVDQTRVCRNRYE
VLQRLQTTPLLLIGGERLVAPLLHQLAQAGLGRATWLANSAPTTTYALPHLALDLQVPQADQLPAAVDHW
LAEHHDGLICLLTSTAQAELTQALNQRAIQAQTRFTRLWLHPQHIELGPTTFAGEAGCYACAEQVDSHEP
QLSEPTAPLSLNEQLALSQASLVVGNLISGLSPVITGGVRYVLDPTTLEFVAQSVHRLVLCPVCGQPNLD
APRDLLVGAGHFENLPLWYHANTDERSYAIFPKAHQQHYAPKNAIAIVSGAKGYTNSQRYALGELQGQWQ
PDSTVDLSVQLPVQTSIAPLAWLFEQAFVRKPATQVIAAGQRFVPSGGNLASQTVYLLNHKLSNLAAGIY
HLNQHDASLEAMRPQFSWDDVAKAFPSDPLNQQTLGLIVLTAAIGRVEGKYGAKSYRIALYDCGVAAQAI
EFLAAAAGWQIEQISAFYDQELRDLLQVYSPSETPLLVLRLVAPNPEVLQ