Home 

Gene Symbol:  
BB14905_21668
Organism:  
Bacillus sp. B14905
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
53288..54121 [1], 834 bp
Product Function:  
Lantibiotic biosynthesis protein
Product Locus:  
 ZP_01724947.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:834 bp
>BB14905_21668|ThioFinder909 Bacillus sp. B14905
ATGTGGGTATCTAAACATTTATTCATTCATGATTATGTCTTAATTGAAGAATTTTTAAAAGAGTGTTTGT
TGCCATATTTAGATAGAGAAAAAGTTCGATATTTTTTCATTCGTTATTGGGATGGTGGTCCCCATATCCG
ATTGAGATACCAAACAGCACAAGACGCAGCAGAAAAAATTGAAAAAGAATTGGAGCACTTATTGGAGAGC
TTTCATCTAAAGCATAGTAGTCACTCATTTCAAGCTATTTCCTATGATGAGGCGATCATTCAGACAGAAG
GCATTGTACCAACTGCTCCGTATCCGAACTTTTCAATTCAGGCGATCGAGTATGTACCAGAGCTAAACCG
TTATGGGGGGGAGGCAGCAATGGCGTTGTCTGAAGAACTATTTGTCCACTCTTCAAAATTTGCTGGACAA
ATTATTCAAAAGCTTAATCGAACTCAGCGTTATGTGTTAGCCATTGACCTCATGTATAACTGTACAAAAA
TTGCTCAAGAATTAGGATATATTGAGAAGCATGAGACAATGTTTCATGCGTATCGTGAAATATGGACTCA
ATTTTCTCAAAATAAGACCCCAGAGCAAATATATAAAGTGATTAACAACAGAATCGATCAATTGAAAAAT
GGAGAACTTGCCATTGAATTCTATCAGCCCTATCTTAAGGTTTTTAAATCTATGCTTGCTCAAATAAAGT
TATGTCAAACGACAATGGAGCCAAAGTACGCCTTTTATATTGTCATTTCTCATCTTCATATGTTGAATAA
TCGATTAGGGGTATCTCCGGAATATGAATTCATTTTTTCAGATGCTTTTCTTAAAGCTGGGTGA
 Primer design

Protein Sequence:277 a.a.
>BB14905_21668|ThioFinder909 Bacillus sp. B14905
MWVSKHLFIHDYVLIEEFLKECLLPYLDREKVRYFFIRYWDGGPHIRLRYQTAQDAAEKIEKELEHLLES
FHLKHSSHSFQAISYDEAIIQTEGIVPTAPYPNFSIQAIEYVPELNRYGGEAAMALSEELFVHSSKFAGQ
IIQKLNRTQRYVLAIDLMYNCTKIAQELGYIEKHETMFHAYREIWTQFSQNKTPEQIYKVINNRIDQLKN
GELAIEFYQPYLKVFKSMLAQIKLCQTTMEPKYAFYIVISHLHMLNNRLGVSPEYEFIFSDAFLKAG