Home 

Gene Symbol:  
BB14905_21638
Organism:  
Bacillus sp. B14905
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
45019..47496 [1], 2478 bp
Product Function:  
Lanthionine biosynthesis protein
Product Locus:  
 ZP_01724941.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2478 bp
>BB14905_21638|ThioFinder903 Bacillus sp. B14905
TTGACTATAATCGTTACTCAAAATCCATTTAGTATTTATCGAGGAACCAATACTTCTGATCAGTGGTACT
TTGAAATGAGAGAAAAAGCGAAGGAAATTCAGTCTGCTAAAGAAGCGATTGACAATGTTCATGCAAAAGT
TGAAAGAGAGAAAGAAATGGTAGTCAGTCAAATTGAAGAAGAGTTCTCTCTACAAAAGGATCCGAAGCTA
TTGAATCTGAAACGGGATGTTCATAATTTGCGTAGCATTCGTTTAAGGAAATACTCAGGGCCAATTTTAT
TGACTCGACTAGTAGAGCTTTTAGATCAATTAGAGTTGTATCAAGAAGCACTGCAACAAAGGTATGAGGA
AGCTGTATTGAAGTCAAGAGAGATTCTGCAACGAGAAATAGCAGATGAGCAGTTGCAAAAGACCGTTTTA
TTTTTTAATCAAACTATTTATAAGAACATTGAAAAATATTTATCCAAACCTGTCCAAACACATAATAAAA
AAGAAAAAAAGTTGGACAATTTTATTATCAACTTGTTAATGCGCAGCTCTATGAAGACTAGTCCGTTTTC
TTATCTTACGCAAACAGGCTCTTCTGGTAATCGATTTTTAATCAAAAAGAAGGCAAATATCGAATTAAAC
CATGCGCTACTTTTTAGAATATTTTTGGAAGTTATTCGTACGAACAATGATACATTAGAAAAAATTCCAG
TCCATGTTTCTAAATTTGGGCAAAGGAATTCTAAAATCTTTTTTGTCACGCAAGAGAATGTACCGCAATC
TAAGAAAATATATGAAACAAGAGATAAGCTGGTTGAGATGGGGATTGCGGAAGAAGTAATTCAATTTCTA
AAGAAAAAACAAGGGCAAACTATGTATTATAAAGAATTTGCTCAATTTCTAAGTGAACATGATCTTTATT
CGGGGCATGAGTTGGATGTATTTAAAAAGCTTGTTACTACGAAAATCGTAGTACAAAAAATTTCAGTAAA
TGCTAAAAGAAATCTTGTAGAAGAAATGATTTCCTATTTAAAAGACCATGATATTTGCGAAGAGCTATCA
CGCCAGCTGCAATTCATTAATGAATTGCAAAAGGAATTCGAGCAGGCAGATACAAATGGGCGGTTAGTTC
TTTGGAAAAAGATTGAGGATATTATTAAAAATTTGAGTGAAACTATTCCTAATTTTGGTACGGAGATTCT
ATATGAAGATATCTTGTTTGATGCTCAAAGTAATAAGAGCAGCCTTAAAGATATTGACAATAAATTTTCT
AATCATTTCTTTGAAGAAATTACGGCATTTTTACTGTTGTTTGATGTGAATATTCGTGTGCAATACGAAG
TTGCTGCGCTTTATAAAAAAATATATGGGCACTCGGAGATAAGTTTATCTGACAGCAATTTATTAAACAA
TGTATTCTTCGAAAAATTGAGATACTTCTTCCCTTATTTCCAAGACATGGATTACCGCTATGATGACGCG
ATTGCACCTGAAGTAAAGATTTTGGATGATCTTAGAGACGAATTTAAAGCATTCTTTTCCCAATACTTAG
ATGAAAATCAAGATGTAGAAATAGATTTTCAGGAACTAATCAAGCCCTTCTCTAAAAAAATTCCTACGTA
TATTAAATACGGCAATGAATTTAGTATGACATTCTTTTATCAGCTTTTTCAGGAGAAAGTAATTTTAAAC
GATATTTATGACGGTCAGGAGAAATTTTTATCCAGGTTTAAAGACTTCTTTGAGGATTTGAATAATGATT
CACAGTATCAAGAATATATAGGGAAAAATTATTATGATAAAAATTATTATGAAGTGACAGAGCTGTTTGG
ATTTAATGGCGGTATTCATGATAGAAATTATAAACAAAAATTAAATTTAGAGTTTGGAAATCAGAGATTC
CATGATGTTGGTTATCCTCATATATCAGATTTTTCGGTTAAATACGATGAGAAAACGAAAAAATTGAAAG
TGCTCGACCATCAGAAAAATGAAGCAAGGGTCGCCTATAAATCGTCATTAGTGCCAGTGTTTCTACCAGG
TGTTTTATCTGTATTGTTACTTCTGTTTCAAAGCGGAAGAATTAACTTTGATATAAATTACTTTTTGAAA
AAAAGAAGTGATATGCCAAGAATTAGTTTTGAAAATATTGTGATGTACAGGAAGAAGTGGAATATCAAAC
ACGAGGATATTGAGCGTATAAGCAAGGATGCGGCAAATGAAGTAGAGCTGTATTCATTAATAAATAACTA
TTTTCAAGACAGAGATTTACCGGAAACTTTCTTTTTAAAGAAATATCGTATGGGTGAAGAAATTTCTGCG
ATGAAGCCATTGTTTATTGATATTACAGTACCCATACTATTCAAACATTTTATGAATGAAATTACTAATG
AAGAAAGTGAAGATCCTACGTTCTTTATCGAAGAGGTGTTACCTGAATTTAATAATGAGCTTAGGGAATA
TGTTGTGGAATATACGATTGACAATTAG
 Primer design

Protein Sequence:825 a.a.
>BB14905_21638|ThioFinder903 Bacillus sp. B14905
MTIIVTQNPFSIYRGTNTSDQWYFEMREKAKEIQSAKEAIDNVHAKVEREKEMVVSQIEEEFSLQKDPKL
LNLKRDVHNLRSIRLRKYSGPILLTRLVELLDQLELYQEALQQRYEEAVLKSREILQREIADEQLQKTVL
FFNQTIYKNIEKYLSKPVQTHNKKEKKLDNFIINLLMRSSMKTSPFSYLTQTGSSGNRFLIKKKANIELN
HALLFRIFLEVIRTNNDTLEKIPVHVSKFGQRNSKIFFVTQENVPQSKKIYETRDKLVEMGIAEEVIQFL
KKKQGQTMYYKEFAQFLSEHDLYSGHELDVFKKLVTTKIVVQKISVNAKRNLVEEMISYLKDHDICEELS
RQLQFINELQKEFEQADTNGRLVLWKKIEDIIKNLSETIPNFGTEILYEDILFDAQSNKSSLKDIDNKFS
NHFFEEITAFLLLFDVNIRVQYEVAALYKKIYGHSEISLSDSNLLNNVFFEKLRYFFPYFQDMDYRYDDA
IAPEVKILDDLRDEFKAFFSQYLDENQDVEIDFQELIKPFSKKIPTYIKYGNEFSMTFFYQLFQEKVILN
DIYDGQEKFLSRFKDFFEDLNNDSQYQEYIGKNYYDKNYYEVTELFGFNGGIHDRNYKQKLNLEFGNQRF
HDVGYPHISDFSVKYDEKTKKLKVLDHQKNEARVAYKSSLVPVFLPGVLSVLLLLFQSGRINFDINYFLK
KRSDMPRISFENIVMYRKKWNIKHEDIERISKDAANEVELYSLINNYFQDRDLPETFFLKKYRMGEEISA
MKPLFIDITVPILFKHFMNEITNEESEDPTFFIEEVLPEFNNELREYVVEYTIDN